DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr36a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:443 Identity:98/443 - (22%)
Similarity:167/443 - (37%) Gaps:117/443 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLGLAPFRLNLNPRKEVQTSKFSFFAGIVHFLF-FVLCFGISVKEGDSIIGYFFQTN-------I 83
            ::||..|.::....:.|...:...||..::.|. .||...||.|....:  ||.:.|       |
  Fly    18 IIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDV--YFGRANQLHQYVII 80

  Fly    84 TRFSDGTLRL-TGILAMSTIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGMKLDY-----RRILLS 142
            ...|   ||: :||.|:...:.    :|.:|:.::       |..:||.:|..:     |..:|.
  Fly    81 VMVS---LRMASGISAILNRWR----QRAQLMRLV-------ECVLRLFLKKPHVKQMSRWAILV 131

  Fly   143 SFLISLGMLLFNVIYLCVSYSLLVSATISPSFV----TFTTFALPHINIS--LMVFKFLCTTDLA 201
            .|  |:| ::.|.:.:.:|...|.....: .||    .|...|:.::.||  .:|..|:      
  Fly   132 KF--SVG-VVSNFLQMAISMESLDRLGFN-EFVGMASDFWMSAIINMAISQHYLVILFV------ 186

  Fly   202 RSRFSML-NEILQDILDAHIEQLSALELSPMHSVVNHRR---------YSHRLRNLISTPMKRYS 256
            |:.:.:| .|:.|           |:..|.|.|.:..||         .:.|:.|:.....:..|
  Fly   187 RAYYHLLKTEVRQ-----------AIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQNQLQS 240

  Fly   257 VTSVIRLNPEYAIKQVSNIHNLLC----DICQTIEEYFTYPL---------LGIIAISFLFILFD 308
            :  |.:||      ||..|..::.    .|......|.||.|         |.:.|.:.:|..| 
  Fly   241 I--VTQLN------QVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVFSWF- 296

  Fly   309 DFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHKILNIT 373
            .||...||||             .|.:::|......:..|:|  .||:    :|:|:        
  Fly   297 LFYYTSAILN-------------LFVMLKLFDDHKEMERILE--ERTL----FTSAL-------- 334

  Fly   374 DDPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQF 426
             |..|......:.|||....:......:|.:.|:....:.|:.....|.|||:
  Fly   335 -DVRLEQSFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 98/443 (22%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 98/443 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.