DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr36c

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:463 Identity:86/463 - (18%)
Similarity:158/463 - (34%) Gaps:159/463 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SFFAGIVHFLFFVLCFGISVKEGDSIIGYFFQTNITR-FSDGTLRLTGILAMSTIFGFAMFKRQR 112
            ||..|.|:  ::.|..|:|        .:.|..|..| |:.....|..|...|.||...::    
  Fly     5 SFLLGAVY--YYGLFIGLS--------NFEFDWNTGRVFTKKWSTLYAIALDSCIFALYIY---- 55

  Fly   113 LVSIIQNNIVVDEIFVRLGMKLDYRRILLSSFLISLGM--------------------------- 150
              ....|..:|:.||.|..|..:|...:|:...|..|:                           
  Fly    56 --HWTGNTNIVNAIFGRANMLHEYVVAILTGLRIVTGLFTLILRWYQRCKMMDLASKVVRMYVAR 118

  Fly   151 --------------LLFNVIYLCVSYSLLVSA--TISPSF-----VTFTTFALPHINISL----M 190
                          .:|..|...:..::::||  ::...|     :.:..|.:  :|:::    |
  Fly   119 PQVRRMSRWGILTKFIFGSITDGLQMAMVLSAMGSVDSQFYLGLGLQYWMFVI--LNMAMMQQHM 181

  Fly   191 VFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMH-------------SVVNHRRYSH 242
            :..|:      |::|.::|..|:.::|    :...|.|||.|             .:.|..|...
  Fly   182 IMLFV------RTQFQLINTELRQVID----EAKDLLLSPRHQGVFMTKCCSLADQIENIARIQS 236

  Fly   243 RLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLG----------- 296
            :|:.:::...:.:.:...:.....|    :|::     ..|     |..|.:|.           
  Fly   237 QLQTIMNQMEEVFGIQGAMTYGGYY----LSSV-----GTC-----YLAYSILKHGYENLSMTLS 287

  Fly   297 --IIAISFLFILFDDFYILEAILNPKRLDVF--EADEFFAFFLMQLIWYIVIIVLIVEGSSRTIL 357
              |:|.|:.|     ||.|:.:||   |.|.  ..|::         |.::.|:     ..|||.
  Fly   288 TVILAYSWCF-----FYYLDGMLN---LSVMLHVQDDY---------WEMLQIL-----GKRTIF 330

  Fly   358 HSSYTAAIVHKILNITDDPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLII 422
                          :..|..|.:....|:|||....:..|...|:.:.|:....:.|....:.|.
  Fly   331 --------------VGLDVRLEEAFENLNLQLIRNPLKITVVKLYDVTRSNTMAMFGNLITHSIF 381

  Fly   423 LIQFRFTH 430
            |||:...|
  Fly   382 LIQYDIEH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 85/461 (18%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 83/458 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.