DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr59b

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:324 Identity:57/324 - (17%)
Similarity:114/324 - (35%) Gaps:114/324 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 GMKLDYRRILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFALPHINISLMVFK-- 193
            |::...|.:|...|        |.:.:|||:..|         |:.::|.||..:|:....||  
  Fly   123 GVRRSLRILLFVKF--------FTLSWLCVTDVL---------FLLYSTDALIWVNVLRFFFKCN 170

  Fly   194 ------------FLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRN 246
                        ||....:||. |..:|..|..|:.:             .|...||...|..  
  Fly   171 TNNILEMVPMGYFLALWHIARG-FDCVNRRLDQIVKS-------------KSTRKHRELQHLW-- 219

  Fly   247 LISTPMKRYSVTSVIRLNPEYAIKQV-SNIHNLLCDICQTIEEY----FTYPLLGIIAISFLFIL 306
            |:...:.:    :.:.:|..||.:.: |...|.:..:   |:.|    ||:.|    :..|.:::
  Fly   220 LLHACLTK----TALNINKIYAPQMLASRFDNFVNGV---IQAYWGAVFTFDL----STPFFWVV 273

  Fly   307 FD---------DFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYT 362
            :.         |:|:::.:.:                            :.||          |.
  Fly   274 YGSVQYHVRCLDYYLIDNMCD----------------------------VAVE----------YH 300

  Fly   363 AAIVHKILNITDDPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQF 426
            .:..|....:....|:...:    :..:..|:...:.|||:.:|::.|.:..:...|:::|:||
  Fly   301 DSAKHSWSEVRWTKEISSYV----IYANSTKLQLWSCGLFQANRSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 57/324 (18%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 57/324 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.