DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr93c

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_732665.1 Gene:Gr93c / 117471 FlyBaseID:FBgn0045469 Length:397 Species:Drosophila melanogaster


Alignment Length:441 Identity:83/441 - (18%)
Similarity:160/441 - (36%) Gaps:124/441 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SKFSFFAGIVHF--LFFVLCFGISVKEGD-----------------------SIIGYFFQTNITR 85
            |.|..|.. .|:  :..|:||.|..:..|                       :.:..|....:..
  Fly    14 SAFILFCS-CHYGRILGVICFDIGQRTSDDSLVVRNRHQFKWFCLSCRLISVTAVCCFCAPYVAD 77

  Fly    86 FSDGTLRLTGI--LAMSTIFGFAM------FKRQRLVSIIQNNIVVDEIFVRLGMKLDYRRILLS 142
            ..|...||...  |:.|.|.|..:      ::::.|..||.        |:||     :||:...
  Fly    78 IEDPYERLLQCFRLSASLICGICIIVVQVCYEKELLRMIIS--------FLRL-----FRRVRRL 129

  Fly   143 SFLISLG--------MLLFNVIYLCVSYSLLVSATISPSFVTFTTFALPHINISLMVFKFLCTTD 199
            |.|..:|        :|||.  ::|:.|.|.....           .|.|:..||.:|..||   
  Fly   130 SSLKRIGFGGKREFFLLLFK--FICLVYELYSEIC-----------QLWHLPDSLSLFATLC--- 178

  Fly   200 LARSRFSMLNEILQDI---LDAHIEQLSALELSPMHSVVNH------RRYSHRLRNLISTPMKRY 255
                      ||..:|   :..||..:..|.::.::|.||.      ||....|...:..|:.|.
  Fly   179 ----------EIFLEIGSLMIIHIGFVGYLSVAALYSEVNSFARIELRRQLRSLERPVGGPVGRK 233

  Fly   256 SVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFILFDDFYILEAILNPK 320
            .:..|     ||.:.:..::::.:..:.:|.......|:| ||.:..:|......|  |.|:.| 
  Fly   234 QLRIV-----EYRVDECISVYDEIERVGRTFHRLLELPVL-IILLGKIFATTILSY--EVIIRP- 289

  Fly   321 RLDVFEADEFFAFFLMQLIWYIVI-----IVLIVEGSSRTILHSSYTAAIVHKILNITDDPELRD 380
                    |.:|..:.  :|.:|:     ::|:.     ..:|.:.:::.:.:.|::.:.|....
  Fly   290 --------ELYARKIG--MWGLVVKSFADVILLT-----LAVHEAVSSSRMMRRLSLENFPITDH 339

  Fly   381 RLFRLSLQLSHRKVLF-----TAAGLFRLDRTLIFTITGAATCYLIILIQF 426
            :.:.:..::...::.|     ...|||.:...:|.....:...|...::|:
  Fly   340 KAWHMKWEMFLSRLNFFEFRVRPLGLFEVSNEVILLFLSSMITYFTYVVQY 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 83/441 (19%)
Gr93cNP_732665.1 7tm_7 18..393 CDD:285581 81/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.