DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr22f

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster


Alignment Length:437 Identity:85/437 - (19%)
Similarity:159/437 - (36%) Gaps:124/437 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LLGLAPFRLNLNPRKEVQTSKFSFFAG-IVHFLFFVLCFGIS-------------VKEGDSIIGY 77
            ||||.||..: :.||:::.|::....| ::|.|  .:|..:|             .:....:...
  Fly    28 LLGLFPFTFD-SRRKQLKRSRWLLLYGFVLHSL--AMCLAMSSHLASKQRRKYNAFERNPLLEKI 89

  Fly    78 FFQTNITRFSDGTLRLTGILAMSTIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGMKL----DYRR 138
            :.|..:|.|    ..::.:|.|:.       .:...|..|.|.::..|..|:..:.|    ::..
  Fly    90 YMQFQVTTF----FTISVLLLMNV-------WKSNTVRKIANELLTLEGQVKDLLTLKNCPNFNC 143

  Fly   139 ILLSSFLISLGMLLFNVIYLCV----SYSLLVSATISPSFVTFTTFALPHINISLMVFKFLCTTD 199
            .::...:.::|..:.: ||.|:    ||..::....          .||.:.:.|::..|.....
  Fly   144 FVIKKHVAAIGQFVIS-IYFCLCQENSYPKILKILC----------CLPSVGLQLIIMHFHTEII 197

  Fly   200 LARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMKRYSVTSVIRLN 264
            |......::||.|:|                     :|...|.|:..|.|...:...::.::   
  Fly   198 LVYRYVWLVNETLED---------------------SHHLSSSRIHALASLYDRLLKLSELV--- 238

  Fly   265 PEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFIL---FDDFYIL-----EAILNPKR 321
                         :.|:..|.|.....|.:...:.|.||.:|   .:..||.     :.|:|   
  Fly   239 -------------VACNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIIN--- 287

  Fly   322 LDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHKILNI-----TDDPELRDR 381
                    |:.|:|     .||:..|..:...:|           .|:|.:     .||.||...
  Fly   288 --------FWDFWL-----NIVVCDLAGKCGDQT-----------SKVLKLFTDLEHDDEELERS 328

  Fly   382 LFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRF 428
            |...:...:|||..|...|||.::..:.|.:...:..||:.|:||.|
  Fly   329 LNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQFDF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 85/437 (19%)
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 85/437 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.