DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr8a

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:432 Identity:95/432 - (21%)
Similarity:169/432 - (39%) Gaps:136/432 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FHPYLKYFALLGL----VPWSESCAQSKFVQKVYSAILII-LNAVHFGISIYFPQSAELFL---- 60
            ||  |:.:.:||.    :|...:.|:::.....:|..|:| |:|:  .::..|  |.|.||    
  Fly    11 FH--LRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSAL--VLACLF--SGEEFLYRGD 69

  Fly    61 --SLMVNVIVFVARIVCVTVIILQVM-----------VHY-------------DDYFRFCREMKY 99
              ....:.:.:|...:.|..|.|:.:           :|:             .::.:|||.:.:
  Fly    70 MFGCANDALKYVFAELGVLAIYLETLSSQRHLANFWWLHFKLGGQKTGLVSLRSEFQQFCRYLIF 134

  Fly   100 LGLRLQCELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSLLYFWSS---LLSILIIR- 160
            |...:..|:.||:|  .||                    :.||:..:|.|||:   |:.:..:| 
  Fly   135 LYAMMAAEVAIHLG--LWQ--------------------FQALTQHMLLFWSTYEPLVWLTYLRN 177

  Fly   161 MQFVLVLLNVELLGHHVSLLGIRLQNVLECHLMGANCTLDGNANRLCSLE------FLLALKQSH 219
            :|||   |::|||  ...|.|:..:       ||    |....:|..|..      |...|::..
  Fly   178 LQFV---LHLELL--REQLTGLERE-------MG----LLAEYSRFASETGRSFPGFESFLRRRL 226

  Fly   220 MQLHYLFTHFNDL-------FGWSILGTYVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVF-- 275
            :|...:::|..|:       |.:|||...:      |:||    ::.|:.|   ::|  :|::  
  Fly   227 VQKQRIYSHVYDMLKCFQGAFNFSILAVLL------TINI----RIAVDCY---FMY--YSIYNN 276

  Fly   276 ---------VPSFFNILVFCRCGEFCQRQSVLIGSYLRNL-------SCHPSIGRETSYKDLLME 324
                     ||:...|..|....:.|......|...|.|:       || |.:..:      :..
  Fly   277 VINNDYYLIVPALLEIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSC-PDLSLQ------IQN 334

  Fly   325 FILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            |.||:....:.|:..|....|.|||..:..:..||:|..:||
  Fly   335 FSLQLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 95/432 (22%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 93/430 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.