DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr59c

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_726292.1 Gene:Gr59c / 192481 FlyBaseID:FBgn0041235 Length:397 Species:Drosophila melanogaster


Alignment Length:387 Identity:80/387 - (20%)
Similarity:146/387 - (37%) Gaps:90/387 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYSAI--------LIILNAVHFGISIYFPQSA---ELFLSLMVNVIVFVARIVCVTVIILQVMVH 86
            :|:|:        ||:.|..:..:...|..:.   |.|..||.        .|.::.::|.::..
  Fly    41 IYAAVHNASLITLLILFNLGNNSLKSEFISARYLHEYFFMLMT--------AVRISAVLLSLITR 97

  Fly    87 YDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSL----- 146
            :....||.|....:...::...::..||  |  |.:.:         :|..::..||.||     
  Fly    98 WYQRSRFIRIWNQILALVRDRPQVVRGR--W--YRRSI---------ILKFVFCVLSDSLHTISD 149

  Fly   147 -----------LYFWSSLLSIL-----IIRMQFVLVLLNVELLGHHVSLLGIRLQNVLECHLMGA 195
                       |....|||:.|     :|..|:.|.::.|      :.|..|.||: |.|.:..|
  Fly   150 VSAQRKRITADLIVKLSLLATLTTIFNMIVCQYYLAMVQV------IGLYKILLQD-LRCLVRQA 207

  Fly   196 NCTLDGNANR-------LCSL-EFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNI 252
            .|.......|       .||| :.|..:.:.|..|.......:|||....|...:|.|..:..:|
  Fly   208 ECICSIRNRRGGVYSIQCCSLADQLDLIAERHYFLKDRLDEMSDLFQIQSLSMSLVYFFSTMGSI 272

  Fly   253 YWTQQVLVEVYEYKYLYATFSVFVPSFFN-ILVFCRCGEFCQRQ--SVLIGSYLRNLS---CHPS 311
            |::        ....||:: :.|..:::. :|:......|....  ||.||.::|:..   ....
  Fly   273 YFS--------VCSILYSS-TGFGSTYWGLLLIVLSTASFYMDNWLSVNIGFHIRDQQDELFRVL 328

  Fly   312 IGRETSYKDL-------LMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            ..|...|::|       ...|.||:..|.......|....:...|:::|::.:|:.:||:|:
  Fly   329 ADRTLFYRELDNRLEAAFENFQLQLASNRHEFYVMGLFKMERGRLIAMLSSVITHTMVLVQW 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 80/387 (21%)
Gr59cNP_726292.1 7tm_7 9..394 CDD:285581 80/387 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.