DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and lite-1

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_509043.3 Gene:lite-1 / 180894 WormBaseID:WBGene00001803 Length:439 Species:Caenorhabditis elegans


Alignment Length:372 Identity:64/372 - (17%)
Similarity:116/372 - (31%) Gaps:161/372 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYSAILIILNAVHFGIS-----IYFPQSAEL-----FLSLMVNVIVFVARIVCVTVIILQVMVHY 87
            |:|.:|.:..|..:.:|     :|...:..|     |..|:.:..:||:|.....:.||      
 Worm   173 VFSGLLALTMAATYAMSKWGYILYIVGTPNLDTETIFCVLLDSYALFVSRAAISALAIL------ 231

  Fly    88 DDYFRFC----REMKYLGLRL------QCEL------KIHVGRLKWQS-----------YAKILA 125
              :::.|    |.:|:|...:      :|.|      |||..::.:|.           |:.:|.
 Worm   232 --FYQHCSVIRRSIKHLINEMVPAEQDECPLPESSLQKIHDCQISYQRIFNGKAVIEEYYSFVLF 294

  Fly   126 LGIGFLVTVLPSI-YVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGIRLQNVLE 189
            ...|..:.:...: :|.:|...: .||.::||:|..:..:||||...|....::..|.||     
 Worm   295 YSYGVCIPIFCFLMFVGMSAQSI-CWSEVVSIVIWIVNAILVLLLFSLPAFMINEDGDRL----- 353

  Fly   190 CHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIYW 254
                                     :..|....|..|....||                      
 Worm   354 -------------------------VASSFRMYHETFHEERDL---------------------- 371

  Fly   255 TQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVLIGSYLRNLSCHPSIGRETSYK 319
              .||.::        ||                                               
 Worm   372 --TVLSQM--------TF----------------------------------------------- 379

  Fly   320 DLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
                 |..|:....|.::|..:...|.|:|:|:.:|.:||.::|.:|
 Worm   380 -----FTFQIHSTKLTLSACNYFYMDRSILLSLFSAILTYFLILWEF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 64/372 (17%)
lite-1NP_509043.3 7tm_7 75..425 CDD:285581 64/372 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.