DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr10a

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:389 Identity:68/389 - (17%)
Similarity:141/389 - (36%) Gaps:99/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFVA----RIVCVTVIILQV--MVHYDD-- 89
            ::|.:||::...:|   .|..::....|...:.::.:|:    .|...|||:..|  .||::.  
  Fly    56 LFSMLLIVVLPGYF---CYHFRTLTDTLDRRLQLLFYVSFTNTAIKYATVIVTYVANTVHFEAIN 117

  Fly    90 -----------------------------YFRFCREMKYLGLRLQ-CELKIHVGRLKWQSYAKIL 124
                                         ||:||  :..|.:.:| |.:....|.:...|.::: 
  Fly   118 QRCTMQRTHLEFEFKNAPQEPKRPFEFFMYFKFC--LINLMMMIQVCGIFAQYGEVGKGSVSQV- 179

  Fly   125 ALGIGFLVTVLPSIYVALSGSLLYFWSSLL---------SILIIRMQFVLVLLNVELLGHHVSLL 180
                        .::.|:...:|:.::..:         |:|....||     |::|......:.
  Fly   180 ------------RVHFAIYAFVLWNYTENMADYCYFINGSVLKYYRQF-----NLQLGSLRDEMD 227

  Fly   181 GIRLQNVLECHLMGANCTLDGNANRLCSL-EFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVL 244
            |:|...:|..|     |         |.| :.|..|::...::|.|......:..:.::|..:..
  Fly   228 GLRPGGMLLHH-----C---------CELSDRLEELRRRCREIHDLQRESFRMHQFQLIGLMLST 278

  Fly   245 FSDSTVNIYWTQQVLVE--VYEYKYLYATFSVFVPSFF-NILVFCRCGEFCQRQSVLIGSYLRNL 306
            ..::..|.|....:|.:  :.|..|.....||:...|: :..:.....|..:.:...:...:|..
  Fly   279 LINNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRF 343

  Fly   307 S----CHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            :    ....:.||..:  |.:| :|..:..:|.    |.:..|..|:..|.....:|.|.|:||
  Fly   344 AEPREMDERLTREIEH--LSLE-LLNYQPPMLC----GLLHLDRRLVYLIAVTAFSYFITLVQF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 68/389 (17%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 68/389 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.