DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr22c

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_722732.2 Gene:Gr22c / 117499 FlyBaseID:FBgn0265138 Length:383 Species:Drosophila melanogaster


Alignment Length:383 Identity:68/383 - (17%)
Similarity:140/383 - (36%) Gaps:126/383 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LFLSLMVNVIVFVARIVC--------------------------VTVIILQVMVHYDDYFRFCRE 96
            ||..|::|..:.: ::||                          :..:...|::|:.:::...|.
  Fly    48 LFYGLILNFFLLL-KMVCSGGQKLGIPEAFARNSVLENTHYTTGMLAVFSCVVIHFLNFWGSTRV 111

  Fly    97 MKYLGLRLQCELKIHVGRLKWQSYA----------------KILALGIGFLVTVLPSIYVALSGS 145
            ..     |..||.:    |::|.:|                |.|:: ||.|::.| ||...|.|:
  Fly   112 QD-----LANELLV----LEYQQFASLNETKCPKFNSFVIQKWLSV-IGLLLSYL-SIAYGLPGN 165

  Fly   146 LLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLL----------GIRLQNVLECHLMGANCTLD 200
            .......|::.|:   ||   ..|..::.:::.:|          |..|:.|....|   :|::|
  Fly   166 NFSVEMVLINSLV---QF---SFNCNIMHYYIGVLLIYRYLWLINGQLLEMVTNLKL---DCSVD 221

  Fly   201 GNA--------NRLCSLE-FLLALKQSHMQLHY---LFTHFNDLFGWSILGTYVVLFSDSTVNIY 253
            .:.        .||..|: :::|..:.||.|..   |.::|..::.|.:|        |.::||.
  Fly   222 SSRIRKYLSLYRRLLELKGYMVATYEYHMTLVLTTGLASNFLAIYSWIVL--------DISMNIN 278

  Fly   254 WTQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQR-----QSVLIGSYLRNLSCHPSIG 313
                     :.|..::..|  .:.:.:|:.:.....:..:.     |:||            .:.
  Fly   279 ---------FIYLLIFPLF--LLVNVWNLWLSIAASDLAENAGKSTQTVL------------KLF 320

  Fly   314 RETSYKDL-----LMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            .:...||:     :.||.|.........:..|..:.:..:...::.....|||.::||
  Fly   321 ADLEVKDIELERSVNEFALLCGHCQFNFHVCGLFTINYKMGFQMIITSFLYLIYMIQF 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 68/383 (18%)
Gr22cNP_722732.2 7tm_7 17..382 CDD:285581 68/383 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.