DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr22e

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_722731.1 Gene:Gr22e / 117498 FlyBaseID:FBgn0045497 Length:389 Species:Drosophila melanogaster


Alignment Length:431 Identity:81/431 - (18%)
Similarity:145/431 - (33%) Gaps:151/431 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGLVP-----WSESCAQSK------FVQKVYSAILIILNAVHFGISIYFPQSAELF----LSLM 63
            :||:.|     |:.:..:||      ||......:|::.|......    |...|:|    |:..
  Fly    27 ILGVFPFAYDSWTRTLRRSKWLIAYGFVLNAAFILLVVTNDTESET----PLRMEVFHRNALAEQ 87

  Fly    64 VNVIVFVARIVCVTVIILQVMVHYDD--------------YFR---------FCREMKYLG---- 101
            :|.|..:..:..|::::|:......|              |||         |.|.:.|.|    
  Fly    88 INGIHDIQSLSMVSIMLLRSFWKSGDIERTLNELEDLQHRYFRNYSLEECISFDRFVLYKGFSVV 152

  Fly   102 LRLQCELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSLL-------YFW------SSL 153
            |.|...|.:.:|..  .:|:....:|:|.|..:|.::.:..|...|       |.|      ..|
  Fly   153 LELVSMLVLELGMS--PNYSAQFFIGLGSLCLMLLAVLLGASHFHLAVVFVYRYVWIVNRELLKL 215

  Fly   154 LSILII-------RMQFVLVLLNVELLGHHVSLLGIRLQNVLECHLMGANCTLDGNANRLCSLEF 211
            ::.:.|       ||..:|.|.      |.:..||.||.::.:..::            :..:.|
  Fly   216 VNKMAIGETVESERMDLLLYLY------HRLLDLGQRLASIYDYQMV------------MVMVSF 262

  Fly   212 LLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVFV 276
            |:|                     ::||.|..:....::|         :..::|.|     |||
  Fly   263 LIA---------------------NVLGIYFFIIYSISLN---------KSLDFKIL-----VFV 292

  Fly   277 PSF-FNILVFCRCGEFCQRQSVLIGSYLRNLSCHPSIGRETS-----YKDL----------LMEF 325
            .:. .|:|.|....|.|:...              ..||:||     :.|:          :.:|
  Fly   293 QALVINMLDFWLNVEICELAE--------------RTGRQTSTILKLFNDIENIDEKLERSITDF 343

  Fly   326 ILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            .|......|..:..|....:..:...:......||:.|:||
  Fly   344 ALFCSHRRLRFHHCGLFYVNYEMGFRMAITSFLYLLFLIQF 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 81/431 (19%)
Gr22eNP_722731.1 7tm_7 18..388 CDD:285581 81/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.