DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr28b

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_995642.1 Gene:Gr28b / 117496 FlyBaseID:FBgn0045495 Length:470 Species:Drosophila melanogaster


Alignment Length:393 Identity:87/393 - (22%)
Similarity:150/393 - (38%) Gaps:95/393 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFVARIVCVTVIILQVMVHYDDYFRFCREM 97
            |::..|.|.|......|.:|......|..||..|..|:.    ||||.|...|......|..::.
  Fly    91 VFAYSLTIYNNCESVASYFFRSRITYFGDLMQIVSGFIG----VTVIYLTAFVPNHRLERCLQKF 151

  Fly    98 KYLGLRLQ-CELKIHVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRM 161
            ..:.::|| ..:||...::...||..::::   |||.||   :...:.|:||. |.:...:.:..
  Fly   152 HTMDVQLQTVGVKIMYSKVLRFSYMVLISM---FLVNVL---FTGGTFSVLYS-SEVAPTMALHF 209

  Fly   162 QFVLVLLNVELLGHHVSLLGIRLQN----VLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQL 222
            .|        |:.|.|..:.|.|.:    ::|..|:..|..|...|:: .....|.|:.|....|
  Fly   210 TF--------LIQHTVIAIAIALFSCFTYLVEMRLVMVNKVLKNLAHQ-WDTRSLKAVNQKQRSL 265

  Fly   223 HYLFTHFNDLFGWSILGT--------------YVVLFSDSTVNIYWTQQV--------LVEVYEY 265
            ..|     |.|....:.|              :::..:.:|.|.|:|.|:        |:.|::.
  Fly   266 QCL-----DSFSMYTIVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDA 325

  Fly   266 KYLYATF-----------SVFVPSFFNILVFCRCGEFCQ-------------------RQSVLIG 300
            .|:..|.           :|...:||:          ||                   ::|...|
  Fly   326 YYVLETLLGKSKRESKFKTVEFVTFFS----------CQMILYLIAIISIVEGSNRAIKKSEKTG 380

  Fly   301 SYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQ 365
            ..:.:|.   :..:....|:.|.:|.:|:....:...|.|..:.|.:|..:|..|..||||:|:|
  Fly   381 GIVHSLL---NKTKSAEVKEKLQQFSMQLMHLKINFTAAGLFNIDRTLYFTISGALTTYLIILLQ 442

  Fly   366 FSS 368
            |:|
  Fly   443 FTS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 85/390 (22%)
Gr28bNP_995642.1 7tm_7 45..443 CDD:285581 84/389 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.