DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr22b

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:408 Identity:72/408 - (17%)
Similarity:152/408 - (37%) Gaps:107/408 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGLVPWS-ESCAQSKFVQK-----VYSAIL---IILNAVHFGISIYFPQSAELF----LSLMVN 65
            |||:.|:: :|..:.:.:::     :|..:|   :|...:..... |.....|.|    :..|:|
  Fly    26 LLGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFLIFTLIRLAFE-YRKHKLEAFKRNPVLEMIN 89

  Fly    66 VIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSY---------- 120
            |::.:..::..      ::||:         |.:.|.|...|:...:..|::|.:          
  Fly    90 VVIGIINVLSA------LIVHF---------MNFWGSRKVGEICNELLILEYQDFEGLNGRNCPN 139

  Fly   121 ------AKILALGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSL 179
                  .|.|.: :|.|::.. ::..||.|...:....|||.|   |:|   .||:.::.:||.:
  Fly   140 FNCFVIQKCLTI-LGQLLSFF-TLNFALPGLEFHICLVLLSCL---MEF---SLNLNIMHYHVGV 196

  Fly   180 LGI---------RLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGW 235
            |.|         :|::::.                    :..|..:....::|...:.:..|.. 
  Fly   197 LLIYRYVWLINEQLKDLVS--------------------QLKLNPETDFSRIHQFLSLYKRLLE- 240

  Fly   236 SILGTYVVLFSDSTVNIYWTQQV---LVEVY---EYKYLYATFSVFVPSFFNILVF--------- 285
              |...:|:..:..:.::...|:   :|.:|   .|.....|:|:|:.:|.|.|:.         
  Fly   241 --LNRKLVIAYEYQMTLFIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLINIWDFWLCI 303

  Fly   286 --CRCGEFCQRQSVLIGSYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSL 348
              |...|....::.:|.....:|. |    |:...:..:.||..............|..|.:..:
  Fly   304 AACDLTEKAGDETAIILKIFSDLE-H----RDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMNCRM 363

  Fly   349 LMSILAAKVTYLIVLMQF 366
            ...::.....||:.|:||
  Fly   364 GFKMIITTFLYLVYLVQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 72/408 (18%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 72/408 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.