DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr36a

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:420 Identity:78/420 - (18%)
Similarity:150/420 - (35%) Gaps:112/420 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YFALLGL----VPWSES---CAQSKF-----VQKVYSAILIILNAVHFGISIYFPQSAELFLSLM 63
            |..::||    :.|...   .||...     :..:...:|::..:..|.:.:||.::.:|.    
  Fly    15 YGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKKFNLDVYFGRANQLH---- 75

  Fly    64 VNVIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKI-----HVGRL-KWQSYAK 122
                    :.|.:.::.|::...........|:...|...::|.|::     ||.:: :|     
  Fly    76 --------QYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECVLRLFLKKPHVKQMSRW----- 127

  Fly   123 ILALGIGFLVTVLPS-IYVALS-------------GSLLYFWSS----------LLSILIIRMQF 163
              |:.:.|.|.|:.: :.:|:|             |....||.|          .|.||.:|..:
  Fly   128 --AILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAISQHYLVILFVRAYY 190

  Fly   164 VLVLLNVELLGHHVSLLG----IRLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHY 224
            .|:...|....|...:|.    .|...:.:|      |.|....:.:..|:         .||..
  Fly   191 HLLKTEVRQAIHESQMLSEIYPRRAAFMTKC------CYLADRIDNIAKLQ---------NQLQS 240

  Fly   225 LFTHFNDLFGWS---ILGTYVVLFSDSTVNIYWTQQVLVEVYEYKYLYATFSVFVPSFF------ 280
            :.|..|.:||..   :.|.|.: ||.:|.  |.|..:.:...|..:|....:..|.|:|      
  Fly   241 IVTQLNQVFGIQGIMVYGGYYI-FSVATT--YITYSLAINGIEELHLSVRAAALVFSWFLFYYTS 302

  Fly   281 ---NILVFCRC------GEFCQRQSVLIGSYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAI 336
               |:.|..:.      .|....:..|..|.|       .:..|.|::.:.::.|    :|.|.|
  Fly   303 AILNLFVMLKLFDDHKEMERILEERTLFTSAL-------DVRLEQSFESIQLQLI----RNPLKI 356

  Fly   337 NAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366
            ......:...|...:::.:.:|..|.|:|:
  Fly   357 EVLDIFTITRSSSAAMIGSIITNSIFLIQY 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 78/420 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 78/420 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.