DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr36b

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:407 Identity:84/407 - (20%)
Similarity:147/407 - (36%) Gaps:102/407 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ILIILNAVH-----FGISIY-FP-QSAELFLSLMVNVIVFVARIVCVTVIILQVMVHYDD--YFR 92
            ::::|.|||     .|:|.: |. ::..:|.|....:..|:|.|..:..||.....|.|.  .|:
  Fly     5 VVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYNFTAHGDTNLLFQ 69

  Fly    93 FCREMKYLGLRLQCELKIHVGRL----KWQSYAKILAL--------------------GI---GF 130
            ...::....:.:...|||..|.:    :|....:::.|                    ||   .|
  Fly    70 SANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVIRLYMINPQLKSMIRWGILLKAF 134

  Fly   131 LVTVLPSIYVALS-------------GSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGI 182
            :...:..:.|.||             |.|:....|.:..|.|...|:::|    |:.....::..
  Fly   135 ISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAISQHFLVIL----LIRAQYRIMNA 195

  Fly   183 RLQNVLECHLMGANCTLDGNA--NRLCSL-EFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVL 244
            :|:.|:|.....:...|...|  .|.|.| :.|..:.:...||..:....:::||...|..|   
  Fly   196 KLRMVIEESRRLSFLQLRNGAFMTRCCYLSDQLEDIGEVQSQLQSMVGQLDEVFGMQGLMAY--- 257

  Fly   245 FSDSTVNIYWTQQVLVEVYEY----KYLYATFSVFV-----PSFFNILVFCRCGEFCQRQSVLIG 300
             |:..::|..|..:...:|:|    ..|.|..|:.|     ..:.:.||.|             .
  Fly   258 -SEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLDALVNC-------------N 308

  Fly   301 SYLRNLSCHP----------------SIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLL 349
            :.||.|..|.                .|..|.|::.|.    ||:.:|.|.||..|.........
  Fly   309 NMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQ----LQLARNPLKINVMGMFPITRGST 369

  Fly   350 MSILAAKVTYLIVLMQF 366
            .::.|:.:...|.|:||
  Fly   370 AAMCASVIVNSIFLIQF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 84/407 (21%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 84/403 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.