DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr36c

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_724040.1 Gene:Gr36c / 117486 FlyBaseID:FBgn0045485 Length:390 Species:Drosophila melanogaster


Alignment Length:402 Identity:67/402 - (16%)
Similarity:151/402 - (37%) Gaps:108/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 WS-------ESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFVARIVCVT 77
            ||       :||..:.::.. ::....|:||: ||       .|.:....:|.::..:..:..:.
  Fly    37 WSTLYAIALDSCIFALYIYH-WTGNTNIVNAI-FG-------RANMLHEYVVAILTGLRIVTGLF 92

  Fly    78 VIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGR------LKWQSYAKIL------ALGIGF 130
            .:||:       :::.|:.|. |..::   ::::|.|      .:|....|.:      .|.:..
  Fly    93 TLILR-------WYQRCKMMD-LASKV---VRMYVARPQVRRMSRWGILTKFIFGSITDGLQMAM 146

  Fly   131 LVTVLPSI----YVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGIRLQ-NVLEC 190
            :::.:.|:    |:.|.   |.:|             :.|:||:.::..|:.:|.:|.| .::..
  Fly   147 VLSAMGSVDSQFYLGLG---LQYW-------------MFVILNMAMMQQHMIMLFVRTQFQLINT 195

  Fly   191 HL----------------MGANCTLDGNANRLCSL-EFLLALKQSHMQLHYLFTHFNDLFG---- 234
            .|                .|...|      :.||| :.:..:.:...||..:.....::||    
  Fly   196 ELRQVIDEAKDLLLSPRHQGVFMT------KCCSLADQIENIARIQSQLQTIMNQMEEVFGIQGA 254

  Fly   235 -------WSILGTYVVLFS---DSTVNIYWTQQVLVEVYEYKYLYATFSVFVPSFFNILVFCRCG 289
                   .|.:||..:.:|   ....|:..|...::..|.:.:.|     ::....|:.|.....
  Fly   255 MTYGGYYLSSVGTCYLAYSILKHGYENLSMTLSTVILAYSWCFFY-----YLDGMLNLSVMLHVQ 314

  Fly   290 EFCQRQSVLIGSYLRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILA 354
            :.......::|.  |.:.....:..|.::::|.::.|    :|.|.|..........|..|::..
  Fly   315 DDYWEMLQILGK--RTIFVGLDVRLEEAFENLNLQLI----RNPLKITVVKLYDVTRSNTMAMFG 373

  Fly   355 AKVTYLIVLMQF 366
            ..:|:.|.|:|:
  Fly   374 NLITHSIFLIQY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 67/402 (17%)
Gr36cNP_724040.1 7tm_7 8..389 CDD:285581 67/402 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.