DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr59a

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:397 Identity:79/397 - (19%)
Similarity:140/397 - (35%) Gaps:77/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YLKYFALLGLVPWSESCAQSKFVQ-KVYSAILIILNAVHFG-ISIYFPQSAELFLSL--MVNVIV 68
            |..|...:|:.  |......||.| ::.....:::||:... :...|.:||:|..:.  |.:.:.
  Fly     8 YNVYAVFIGMT--SYETMGGKFRQSRITRIYCLLINAIFLTLLPSAFWKSAKLLSTADWMPSYMR 70

  Fly    69 FVARIVCVTVIILQVMVHYDDYFRFCREMKYLGL-RLQCELK---IHVGRLKWQSYAKILALGIG 129
            ....|:|.   |....:.|....|..|:...:.| |:..|:.   :..|: |..|..:.:     
  Fly    71 VTPYIMCT---INYAAIAYTLISRCYRDAMLMDLQRIVLEVNREMLRTGK-KMNSLLRRM----- 126

  Fly   130 FLVTVLPSIYVALSGSLLYF--------WSSLLSILIIRMQFVLVLLNVELLGHHVSLLGI---- 182
            |.:......|..||..|..|        ||:|.:.|::.:.  |.:|.|....:..||..|    
  Fly   127 FFLKTFTLTYSCLSYILAVFIYQWKAQNWSNLCNGLLVNIS--LTILFVNTFFYFTSLWHIARGY 189

  Fly   183 -----RLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYV 242
                 :|..::.|..|    .|:..:..|..|..|      |..|.|.....|..:|..:|....
  Fly   190 DFVNQQLNEIVACQSM----DLERKSKELRGLWAL------HRNLSYTARRINKHYGPQMLAMRF 244

  Fly   243 VLFSDSTVN-----IYWT---QQVLVEVY-EYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVL 298
            ..|..|.:|     ||.|   :..|.::: ...|...:|..|:..:           .|.    |
  Fly   245 DYFIFSIINACIGTIYSTTDQEPSLEKIFGSLIYWVRSFDFFLNDY-----------ICD----L 294

  Fly   299 IGSYLRNLSCHPS-IGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIV 362
            :..|    ...|. ...|:|..:.|..:::......|.:...|....:....:.::.:.|.:..:
  Fly   295 VSEY----QMQPKFFAPESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSM 355

  Fly   363 LMQFSSV 369
            |.||..|
  Fly   356 LFQFHLV 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 77/393 (20%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 79/397 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.