DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr28a

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster


Alignment Length:458 Identity:95/458 - (20%)
Similarity:162/458 - (35%) Gaps:153/458 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVH-------FGISI--------YFPQ---- 54
            |.:.:||||.|:..:....|.||.  |........||       ||||:        ||.|    
  Fly    22 LTFISLLGLAPFRLNLNPRKEVQT--SKFSFFAGIVHFLFFVLCFGISVKEGDSIIGYFFQTNIT 84

  Fly    55 ---------SAELFLSLMVNVIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKI 110
                     :..|.:|.:....:|..:.:   |.|:|..:..|:.|            ::..:|:
  Fly    85 RFSDGTLRLTGILAMSTIFGFAMFKRQRL---VSIIQNNIVVDEIF------------VRLGMKL 134

  Fly   111 HVGRLKWQSYAKILALGIGFLVTVLPSIYVALSGSLLY----------FWSSLLSILIIRMQFVL 165
            ...|:...|:  :::||: .|..|   ||:.:|.|||.          |.:..|..:.|.:....
  Fly   135 DYRRILLSSF--LISLGM-LLFNV---IYLCVSYSLLVSATISPSFVTFTTFALPHINISLMVFK 193

  Fly   166 VLLNVELLGHHVSLLGIRLQNVLECHLMGANCTLDGNANRLCSLEFLLALKQSHMQL---HYLFT 227
            .|...:|.....|:|...||::|:.|                 :|.|.||:.|.|..   |..::
  Fly   194 FLCTTDLARSRFSMLNEILQDILDAH-----------------IEQLSALELSPMHSVVNHRRYS 241

  Fly   228 H-------------------------------------------FNDLFGWSILGTYV-----VL 244
            |                                           ..:.|.:.:||...     :|
  Fly   242 HRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFIL 306

  Fly   245 FSDSTVNIYWTQQVL----VEVYEYKYLYATFSVFVPSFFNILVFCRCGEFCQRQSVLIGSY--- 302
            |.|    .|..:.:|    ::|:|....:|.|.:.:..:..|:|....|   ..:::|..||   
  Fly   307 FDD----FYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEG---SSRTILHSSYTAA 364

  Fly   303 ----LRNLSCHPSIGRETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVL 363
                :.|::..|.:      :|.|....||:....:...|.|....|.:|:.:|..|...|||:|
  Fly   365 IVHKILNITDDPEL------RDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIIL 423

  Fly   364 MQF 366
            :||
  Fly   424 IQF 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 95/458 (21%)
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 95/458 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.