DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39b and Gr98b

DIOPT Version :9

Sequence 1:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:391 Identity:81/391 - (20%)
Similarity:159/391 - (40%) Gaps:68/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HPYLKYFALLGLVPWSESCAQSKFVQKVYSAILIILNAVHFGISIYFPQSAELFLSLMVNVIVFV 70
            |..|:::.:.|.|.::.:...:.|:...::.|.|....:.:.:|.        |..:|.|:...:
  Fly    36 HRRLRWYLMTGYVFYATAILATVFIVSYFNIIAIDEEVLEYNVSD--------FTRVMGNIQKSL 92

  Fly    71 ARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSYAKILALGIG----FL 131
            ..|:.: ...|.::::|.......:::..|.:.:....:...|:.:..|:...:||.:|    .:
  Fly    93 YSIMAI-ANHLNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILM 156

  Fly   132 VTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGI-----RLQNVL-EC 190
            |..:|.:.:...|.   |.|:||.||   .:||:::..::.|.:.|.:|.|     ||:..| :.
  Fly   157 VGSMPRLTMTAMGP---FVSTLLKIL---TEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQL 215

  Fly   191 HLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIY-- 253
            .....:|........||     :|||::.:.|..::....|: |.....|.::||..:.:.|.  
  Fly   216 QEEFQDCEQQDMLQALC-----VALKRNQLLLGRIWRLEGDV-GSYFTPTMLLLFLYNGLTILHM 274

  Fly   254 --WTQQVLVEVYEYKYLYAT------FSVFVPSFFNILVFCRCGEFCQRQSVLIGSYLRNLSCHP 310
              |       .|..|:||.:      |.|......|:|:.|...:.|      |.:|    :|.|
  Fly   275 VNW-------AYINKFLYDSCCQYERFLVCSTLLVNLLLPCLLSQRC------INAY----NCFP 322

  Fly   311 SI-------GRETSYKDL---LMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQ 365
            .|       ..:.::..|   |.|:.||:|...|.....|....:......:|.....|:|:|:|
  Fly   323 RILHKIRCTSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQ 387

  Fly   366 F 366
            |
  Fly   388 F 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 81/391 (21%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 81/391 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.