DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr68a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:329 Identity:83/329 - (25%)
Similarity:144/329 - (43%) Gaps:63/329 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 DRLVMVIALGILV---VQNAWLIWLQAPHLRIVRQIEFYRRNHLAN-VRLLLPKRLLWLIIATNV 138
            :.|:.:|:..::|   ||||      :.|.|.:..|.......||| .|.....|.|.:::.:  
  Fly    84 ETLLCIISYTMVVLSSVQNA------SRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTS-- 140

  Fly   139 VYMANFIKTCIFEWL-----TDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQ 198
              .|..:....|.::     ..|.|..::         |:..|....|..::.:....|..|.:|
  Fly   141 --AAGGVLAVAFYYIHYRSGIGAKRQIIL---------LLIYFLQLLYSTLLALYLRTLMMNLAQ 194

  Fly   199 INAIIDESADLKMTSPNRLRLRVC------LEMHDRLMLLC-----NDEISLVYGFIAWLSWMFA 252
            ....:::..|       ...|:.|      .|:.:.:.:||     .:.|:.|.|......:.|:
  Fly   195 RIGFLNQKLD-------TFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFS 252

  Fly   253 SLDVTGVIYLTMVIQTKKSIVLKLITNV--------VWLSPTFMT----CAASFMSNRVTIQANK 305
            ...||...||.....|..|:..|  |.|        :|:....:|    |:|   .:.:..:.|.
  Fly   253 FYTVTNQSYLAFATLTAGSLSSK--TEVADTIGLSCIWVLAETITMIVICSA---CDGLASEVNG 312

  Fly   306 TAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKE 370
            ||::|.::.........:|:|||.|:::|....||||||::|.|||||:|:|:.||:|||:|||:
  Fly   313 TAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQ 377

  Fly   371 MENS 374
            :|:|
  Fly   378 LEDS 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 81/325 (25%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 81/325 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016823
OrthoInspector 1 1.000 - - mtm9595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.