DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr59e

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:409 Identity:78/409 - (19%)
Similarity:143/409 - (34%) Gaps:135/409 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWL-----------IWLQAPHLRIVRQIEFY 113
            :||     ..|..|.|.|..:.....:|:|    .||           ||..:    ||:.:||.
  Fly     4 SYW-----ENLLLTINRFLGVYPSGRVGVL----RWLHTLWSLFLLMYIWTGS----IVKCLEFT 55

  Fly   114 RR--------------NHLANVRLLL---------------------------PKRLLWL----- 132
            ..              .::|.:.:|:                           .|||::.     
  Fly    56 VEIPTIEKLLYLMEFPGNMATIAILVYYAVLNRPLAHGAELQIERIITGLKGKAKRLVYKRHGQR 120

  Fly   133 ---IIATNVVYMANFIKTCI--------FE-WLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMV 185
               ::||.:|    |...|:        || |.|.:|...      :.|..|:.|..:..|...|
  Fly   121 TLHLMATTLV----FHGLCVLVDVVNYDFEFWTTWSSNSV------YNLPGLMMSLGVLQYAQPV 175

  Fly   186 HIVRLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLE---------------MHDRLMLLCN- 234
            |.:.||:|    |:...:.|...|:.......:|..|.|               |.:.:...|| 
  Fly   176 HFLWLVMD----QMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNL 236

  Fly   235 -----DEISLVYGFIAWLSWMFASLDVTGVIYLTM-VIQT---KKSIVLKLITNVVWLSP----- 285
                 .:..|.:|....|:.:.:.:.:...:||.. ..:|   ::|::  |:..::||:.     
  Fly   237 IEQVHSQFLLRFGLYLVLNLLNSLVSICVELYLIFNFFETPLWEESVL--LVYRLLWLAMHGGRI 299

  Fly   286 TFMTCAASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLR--QKPILTAYGFFALDK 348
            .|:..    ::.::..|.....::|.::....:.|.|.|.:|||:..|  .:| |.|.|...||.
  Fly   300 WFILS----VNEQILEQKCNLCQLLNELEVCSSRLQRTINRFLLQLQRSIDQP-LEACGIVTLDT 359

  Fly   349 STLFKLFTAIFTYMVILVQ 367
            .:|......:...::.|:|
  Fly   360 RSLGGFIGVLMAIVIFLIQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 78/409 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 76/399 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.