DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr58b

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_523808.2 Gene:Gr58b / 37502 FlyBaseID:FBgn0041238 Length:408 Species:Drosophila melanogaster


Alignment Length:396 Identity:77/396 - (19%)
Similarity:147/396 - (37%) Gaps:80/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KKKFRLRRSVLCYIVHFALQAYLVGCISVMVTYWR-------RCFKSELTTTGNHFDRLVMVIAL 86
            :|..||.:....|.::    ::.||....:..|:.       ...|..:....|.|   ||:...
  Fly    33 RKCLRLEKVSRTYTIY----SFFVGIFLFLNLYFMVPRIMEDGYMKYNIVLQWNFF---VMLFLR 90

  Fly    87 GILVVQNAWLIWLQAPHLRIVRQIEFY--------RRNHLANV-----RLL-LPKRLLWLIIATN 137
            .|.||.....:||:...:     |:.|        |..|:...     .|| |.:.|..::|...
  Fly    91 AIAVVSCYGTLWLKRHKI-----IQLYKYSLIYWKRFGHITRAIVDKKELLDLQESLARIMIRKI 150

  Fly   138 VVYMANFIKTCIFEW-----------LTDASRL-----FVITSLGFPLRYLVTSFTMGTYFCMVH 186
            ::..:.|:.:.:.::           |...:||     |:...:|| ...||   .:...|.::|
  Fly   151 ILLYSAFLCSTVLQYQLLSVINPQIFLAFCARLTHFLHFLCVKMGF-FGVLV---LLNHQFLVIH 211

  Fly   187 IVRLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWMF 251
            :.          |||:....|..|..:     ||....||.:.:.|......:   |....:.:|
  Fly   212 LA----------INALHGRKARKKWKA-----LRSVAAMHLKTLRLARRIFDM---FDIANATVF 258

  Fly   252 ASLDVTGVIYLTMVIQTKKSIVLK-----LITNVVWLSPTFMTCAASFMSNRVTIQANKTA---K 308
            .::.:|.:..|...:|...|.:..     |..|.:.:...:.|.|...|.:.|....|.|.   :
  Fly   259 INMFMTAINILYHAVQYSNSSIKSNGWGILFGNGLIVFNFWGTMALMEMLDSVVTSCNNTGQQLR 323

  Fly   309 MLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEMEN 373
            .|:.:|:.|..:.|.::.|.::..:.:.:....|...|||........:|.:.::||:|| ::..
  Fly   324 QLSDLPKVGPKMQRELDVFTMQLRQNRLVYKICGIVELDKPACLSYIGSILSNVIILMQF-DLRR 387

  Fly   374 STKSIN 379
            ..:.||
  Fly   388 QRQPIN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 75/387 (19%)
Gr58bNP_523808.2 7tm_7 12..385 CDD:285581 75/386 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.