DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr33a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_525102.4 Gene:Gr33a / 34641 FlyBaseID:FBgn0032416 Length:475 Species:Drosophila melanogaster


Alignment Length:191 Identity:45/191 - (23%)
Similarity:84/191 - (43%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 NAIIDESADLKMTSPNRLRLRVCLEMHDRLM---LLCNDEISLVYG--FIAWLSWMFASLDVTGV 259
            ||.|.|:..    :.:...|....::||:::   ::.|.|    :|  .:.:::..|. :.:.|:
  Fly   284 NATIAENTG----NTSEANLPDLFKLHDKILALSVITNGE----FGPQCVPYMAACFV-VSIFGI 339

  Fly   260 IYLTMV--IQTKKSIVLKLIT--NVVWLSPTFMTCAASFMSNRVTIQANKTAK--------MLTK 312
            ...|.|  |...||.:|..:|  .|:|   :|.|...:::..|:...||..:|        ::.|
  Fly   340 FLETKVNFIVGGKSRLLDYMTYLYVIW---SFTTMMVAYIVLRLCCNANNHSKQSAMIVHEIMQK 401

  Fly   313 VPRTGTGLDRMIEK---FLLKNLRQKPI--LTAYGFFALDKSTLFKLFTAIFTYMVILVQF 368
            .|......|....|   |.|:.|..:..  ....|.||||.:.:|...:|..:|:::|:||
  Fly   402 KPAFMLSNDLFYNKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFSTVSAATSYLIVLLQF 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 45/191 (24%)
Gr33aNP_525102.4 7tm_7 <289..465 CDD:303125 42/186 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.