DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr32a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:373 Identity:89/373 - (23%)
Similarity:140/373 - (37%) Gaps:143/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 YIVHF-----ALQAYLVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQN---AWLI 97
            ::|.|     |.|||::    |:..|   ..:.|:|.|.        .|.|....:||   |..|
  Fly   183 FLVKFLVGITACQAYII----VLKIY---AVQGEITPTS--------YILLAFYGIQNGLTATYI 232

  Fly    98 WLQAPHLRIVRQIEFYRRNHL-----------------------------ANVRLL--LPKRLLW 131
            ...:..|||| .|.|:..|.|                             .|..|:  .|:..|:
  Fly   233 VFASALLRIV-YIRFHFINQLLNGYTYGQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDSLF 296

  Fly   132 LIIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQ 196
            :....|.:..       |::.:.|...|.:::.||:.. |.||:   ..|...|.|         
  Fly   297 IYRMHNKLLR-------IYKGINDCCNLILVSFLGYSF-YTVTT---NCYNLFVQI--------- 341

  Fly   197 SQINAIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEISLVYGFIAWLSWMFASLDVTGVIY 261
                      ....|.|||.|:                              |.||.|    .::
  Fly   342 ----------TGKGMVSPNILQ------------------------------WCFAWL----CLH 362

  Fly   262 LTMVIQTKKSIVLKLITNVVWLSPTFMTCAASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEK 326
            ::::....:|..|                        .|.:||.|:::|.:|.........:|:|
  Fly   363 VSLLALLSRSCGL------------------------TTTEANATSQILARVYAKSKEYQNIIDK 403

  Fly   327 FLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEMENS 374
            ||.|:::|:...|||||||:|.|||||:|:|:.||:|||:|||::|:|
  Fly   404 FLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQFKQLEDS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 87/369 (24%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 87/369 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016823
OrthoInspector 1 1.000 - - mtm9595
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.