DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr21a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001259841.1 Gene:Gr21a / 33251 FlyBaseID:FBgn0041250 Length:447 Species:Drosophila melanogaster


Alignment Length:414 Identity:79/414 - (19%)
Similarity:140/414 - (33%) Gaps:110/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LCRYLGIFCIDYNPTKKKFRL------RRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTT 72
            |.:.:|:..|..||.:|....      .:.|:..|..::.|.      :::|...|...|..:|:
  Fly    80 LFQIMGVMPIHRNPPEKNLPRTGYSWGSKQVMWAIFIYSCQT------TIVVLVLRERVKKFVTS 138

  Fly    73 TGNHFDRLVMVIALGILVVQNAWL---IWLQAPHLRIVRQIEFYRRNHLANVRLLLPKRLLWLII 134
            ....||..:..:....|:..|..|   .|...|.:.|.:.                    :|   
  Fly   139 PDKRFDEAIYNVIFISLLFTNFLLPVASWRHGPQVAIFKN--------------------MW--- 180

  Fly   135 ATNVVYMANFIKT-----------------CIFEWL----TDASRLFVITSLGFPLRYLVTSF-- 176
             ||  |...|.||                 |:|.||    .:.|:.|:  ...|.|.|....:  
  Fly   181 -TN--YQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLLSIAINLSQYFL--QPDFRLWYTFAYYPI 240

  Fly   177 -TMGTYFCMVHIV---------RLVLDWNQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLML 231
             .|...||.:..:         |.:.|..|:.|..   |....|:|....|.:.:     ..:|.
  Fly   241 IAMLNCFCSLWYINCNAFGTASRALSDALQTTIRG---EKPAQKLTEYRHLWVDL-----SHMMQ 297

  Fly   232 LCNDEISLVYGFIAWLSWMFASLDVTGVIYLTMVIQTKKSI-----------VLKLITNVVW-LS 284
            ......|.:||....            ||:.|.:|.|..||           .:.|...|.: :.
  Fly   298 QLGRAYSNMYGMYCL------------VIFFTTIIATYGSISEIIDHGATYKEVGLFVIVFYCMG 350

  Fly   285 PTFMTC-AASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDK 348
            ..::.| .|.:.|.:|.:.. :|..:...:........:.:|..|:...:..||:...|:..:::
  Fly   351 LLYIICNEAHYASRKVGLDF-QTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMNLDGYANINR 414

  Fly   349 STLFKLFTAIFTYMVILVQFKEME 372
            ..:....:.:.||:|:|:|||..|
  Fly   415 ELITTNISFMATYLVVLLQFKITE 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 78/412 (19%)
Gr21aNP_001259841.1 7tm_7 75..438 CDD:285581 78/412 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.