DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr10a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:447 Identity:81/447 - (18%)
Similarity:151/447 - (33%) Gaps:152/447 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YRLCRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTTTGNH 76
            ::..||..::.:.|.         :.|:.|:...||               :|..|..|...|:.
  Fly    16 FKFYRYGHVYALIYG---------QVVIDYVPQRAL---------------KRGVKVLLIAYGHL 56

  Fly    77 FDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIEFYRRNHLANVRLLLPKR--LLWLIIATN-- 137
            |..|::|:..|                         |...|...:...|.:|  ||:.:..||  
  Fly    57 FSMLLIVVLPG-------------------------YFCYHFRTLTDTLDRRLQLLFYVSFTNTA 96

  Fly   138 -------VVYMANFIKTCIFEWLTDASRLFVITSLGF--------PLRYLVTSFTMGTYFCMVHI 187
                   |.|:||   |..||.:.....: ..|.|.|        |.|..  .|.|...||::::
  Fly    97 IKYATVIVTYVAN---TVHFEAINQRCTM-QRTHLEFEFKNAPQEPKRPF--EFFMYFKFCLINL 155

  Fly   188 VRLV-----------------------------LDWNQS-----------------------QIN 200
            :.::                             :.||.:                       |:.
  Fly   156 MMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVLWNYTENMADYCYFINGSVLKYYRQFNLQLG 220

  Fly   201 AIIDESADLKMTSPNRLRLRVCLEMHDRLMLL---CND------------EISLVYGFIAWLSWM 250
            ::.||...|:   |..:.|..|.|:.|||..|   |.:            :..|: |.:  ||.:
  Fly   221 SLRDEMDGLR---PGGMLLHHCCELSDRLEELRRRCREIHDLQRESFRMHQFQLI-GLM--LSTL 279

  Fly   251 FASLDVTGVIYLTMVIQTKKSIVLKLITNVVWLSPTFM-TCAASFMSNRVTIQANKTAKMLTKV- 313
            ..:|.....::..:..|:.:.:...::...|:.:..:: |...:.::..:.::....|..:.:. 
  Fly   280 INNLTNFYTLFHMLAKQSLEEVSYPVVVGSVYATGFYIDTYIVALINEHIKLELEAVALTMRRFA 344

  Fly   314 -PR-TGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQF 368
             || ....|.|.||...|:.|..:|.:.. |...||:..::.:....|:|.:.||||
  Fly   345 EPREMDERLTREIEHLSLELLNYQPPMLC-GLLHLDRRLVYLIAVTAFSYFITLVQF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 81/447 (18%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 81/443 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.