DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr22b

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_001014456.1 Gene:Gr22b / 117492 FlyBaseID:FBgn0045500 Length:386 Species:Drosophila melanogaster


Alignment Length:405 Identity:90/405 - (22%)
Similarity:150/405 - (37%) Gaps:98/405 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LGIFCIDYNPTKKKFRLRRS--------VLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTTTG 74
            ||||....:..|:..:||||        ||.|.:.|.|         :.:.:..|..|.|.    
  Fly    27 LGIFPFTLDSGKRIRQLRRSRCLTLYGLVLNYFLIFTL---------IRLAFEYRKHKLEA---- 78

  Fly    75 NHFDR---LVMV-IALGILVVQNAWLIWLQAPHLRIVRQIEFY---RRNHLANVRLLLPKRLLWL 132
              |.|   |.|: :.:||:.|.:|          .||..:.|:   :...:.|..|:|..:....
  Fly    79 --FKRNPVLEMINVVIGIINVLSA----------LIVHFMNFWGSRKVGEICNELLILEYQDFEG 131

  Fly   133 IIATNVVYMANFIKTCIFEWLTDASRLFVITSLGFPLRYL-----------VTSFTMGTYFCMVH 186
            :...|   ..||....|.:.||...:|....:|.|.|..|           :..|::.......|
  Fly   132 LNGRN---CPNFNCFVIQKCLTILGQLLSFFTLNFALPGLEFHICLVLLSCLMEFSLNLNIMHYH 193

  Fly   187 IVRLVL---DW----------NQSQINAIIDESADLKMTSPNRLRLRVCLEMHDRLMLLCNDEIS 238
            :..|::   .|          :|.::|...|.|           |:...|.::.||:.| |.::.
  Fly   194 VGVLLIYRYVWLINEQLKDLVSQLKLNPETDFS-----------RIHQFLSLYKRLLEL-NRKLV 246

  Fly   239 LVYGFIAWLSWMFASLDVTG---VIYLTMVI---QTKKSIVL-----KLITNVVWLSPTFMTC-A 291
            :.|.:...|   |....::|   |||..:|.   ....||.|     .|:.| :|   .|..| |
  Fly   247 IAYEYQMTL---FIIAQLSGNIVVIYFLIVYGLSMRTYSIFLVAFPNSLLIN-IW---DFWLCIA 304

  Fly   292 ASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFT 356
            |..::.:...:.....|:.:.:......|:..:.:|......:|......|.|:::....||:..
  Fly   305 ACDLTEKAGDETAIILKIFSDLEHRDDKLEMSVNEFAWLCSHRKFRFQLCGLFSMNCRMGFKMII 369

  Fly   357 AIFTYMVILVQFKEM 371
            ..|.|:|.||||..|
  Fly   370 TTFLYLVYLVQFDYM 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 90/405 (22%)
Gr22bNP_001014456.1 7tm_7 17..385 CDD:285581 90/405 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.