DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr36a

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:440 Identity:85/440 - (19%)
Similarity:158/440 - (35%) Gaps:144/440 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFQPGELCAYYRLCRYLGI-FCIDYN---------PTKKKFRLRRSVLCYIVHFA----LQAYL 51
            :|:|.|.:.|..|     || |.|..|         ...|||.|.       |:|.    |..|:
  Fly    26 IDWQRGRVVAAQR-----GILFAIAINVLICMVLLLQISKKFNLD-------VYFGRANQLHQYV 78

  Fly    52 VGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVVQNAWLIWLQAPHLRIVRQIE----- 111
               |.|||:                     :.:|.||..:.|.|     ....:::|.:|     
  Fly    79 ---IIVMVS---------------------LRMASGISAILNRW-----RQRAQLMRLVECVLRL 114

  Fly   112 FYRRNHLANVRLLLPKRLLW-LIIATNVVYMANFIKTCIF----------EWLTDASRLFV--IT 163
            |.::.|:..:.       .| :::..:|..::||::..|.          |::..||..::  |.
  Fly   115 FLKKPHVKQMS-------RWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAII 172

  Fly   164 SLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQINAIIDESADLKMTSPNRLR-LRVCLEMHD 227
            ::.....|||..|....|    |:::       :::...|.||..|....|.|.. :..|..:.|
  Fly   173 NMAISQHYLVILFVRAYY----HLLK-------TEVRQAIHESQMLSEIYPRRAAFMTKCCYLAD 226

  Fly   228 RLMLLCNDEIS----------------------LVYG----FIAWLSWMFASLDVTGVIYLTMVI 266
            |:     |.|:                      :|||    |....:::..||.:.|:..|.:.:
  Fly   227 RI-----DNIAKLQNQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSV 286

  Fly   267 QTKKSIVLKLITNVVWLSPTFMTCAASFMSNR-VTIQANKTAKMLTKVPRTGT--------GLDR 322
            :. .::|..      |    |:....|.:.|. |.::.....|.:.::....|        .|::
  Fly   287 RA-AALVFS------W----FLFYYTSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQ 340

  Fly   323 MIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEME 372
            ..|...|:.:|....:.....|.:.:|:...:..:|.|..:.|:|: :||
  Fly   341 SFESIQLQLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQY-DME 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 80/431 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 85/440 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.