DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr39a and Gr98c

DIOPT Version :9

Sequence 1:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:376 Identity:72/376 - (19%)
Similarity:150/376 - (39%) Gaps:64/376 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RRSVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTT----------------TGNHFDRLVMV 83
            :|...|::..::|  ||: .|.:||.|.   |.:.:.:                .|.....|::.
  Fly    39 KRRRFCWMAGYSL--YLI-AILLMVFYE---FHANIVSLHLEIYKFHVEDFSKVMGRTQKFLIVA 97

  Fly    84 IA----LGILV-VQNAWLIWLQAPHLRI---VRQIEFYRRNHLANVRLLLPKRL-LWLIIATNVV 139
            ||    |.||: .....||:.:..:|.:   .....|..::|..:.||.|...: ||::|...|:
  Fly    98 IATCNQLNILLNYGRLGLIYDEIANLDLGIDKSSKNFCGKSHWWSFRLRLTLSIGLWMVIIIGVI 162

  Fly   140 YMANFIKT-CIFEWLTDASRLFVITSLGFPLRYLVTSFTMGTYFCM--VHIVRLVLDWNQSQINA 201
            ......:. ..|.|:..     |:|.:     .|:.....|..:|:  :.:..|:|. .:..:..
  Fly   163 PRLTLGRAGPFFHWVNQ-----VLTQI-----ILIMLQLKGPEYCLFVLLVYELILR-TRHVLEQ 216

  Fly   202 IIDESADLKMTSPNRLRLRVCLEMHDRLMLLCN-----DEISLVYGFIAWLSWMFASLDVTGVIY 261
            :.|:..|....:  |:: .:|:.:....:|:..     |||...:.:...|.:::..|.:..|:.
  Fly   217 LKDDLEDFDCGA--RIQ-ELCVTLKQNQLLIGRIWRLVDEIGAYFRWSMTLLFLYNGLTILHVVN 278

  Fly   262 LTMV--IQTKKSIVLKLITNVVWLS-PTFMTCAASFMSNRVTIQANKTAKMLTKVPRTGTG---- 319
            ..::  |.......|..:.::.:|| ...:||   |.|.......|..:.:|.::....|.    
  Fly   279 WAIIRSIDPNDCCQLNRLGSITFLSFNLLLTC---FFSECCVKTYNSISYILHQIGCLPTAEEFQ 340

  Fly   320 -LDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFK 369
             |...:::::|:....|.:.|..|.|.::......:...:..|::|:||||
  Fly   341 MLKMGLKEYILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQFK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 72/376 (19%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 72/376 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.