DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr93a

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:434 Identity:79/434 - (18%)
Similarity:149/434 - (34%) Gaps:156/434 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 FSGVLLMWFRR--KRILNLGENLILHCLKCKTLDNRSKK--------------YSKL-------- 125
            :|.:||:|..|  :.:|.|..:|....|:.|.....|:.              |:.|        
  Fly    16 WSRLLLLWLYRCARGLLVLSSSLDRDKLQLKATKQGSRNRFLHILWRCIVVMIYAGLWPMLTSAV 80

  Fly   126 -RKRVRNVLFQMLLVANLSILLGALILFRIHS----------------VQRISKTAMIVAHITQF 173
             .||:.:....:.|..::|:.:.|:|.|.|.:                .|||..|..: .|:...
  Fly    81 IGKRLESYADVLALAQSMSVSILAVISFVIQARGENQFREVLNRYLALYQRICLTTRL-RHLFPT 144

  Fly   174 IYVVFMMTGI------CVILLVLHWQSERLQ------------------IALKDLC--SFLNHEE 212
            .:|||.:..:      |...::..:::....                  :.:.|.|  .||    
  Fly   145 KFVVFFLLKLFFTLCGCFHEIIPLFENSHFDDISQMVGTGFGIYMWLGTLCVLDACFLGFL---- 205

  Fly   213 RNSLTLSENKANRSLGKLAKLFKLFAENQRLVREVFRTFDLPIALLLLKMFVTNV-------NLV 270
             .|..|.|:.||..:..|.::..:.::::|.....:|      .:.||..|...:       :.:
  Fly   206 -VSGILYEHMANNIIAMLKRMEPIESQDERYRMTKYR------RMQLLCDFADELDECAAIYSEL 263

  Fly   271 YHGVQFGNDTIETSSYTRIVGQWVVISHYW----------------------------------- 300
            ||         .|:|:.||: ||.::.:.:                                   
  Fly   264 YH---------VTNSFRRIL-QWQILFYIYLNFINICLMLYQYILHFLNDDEVVFVSIVMAFVKL 318

  Fly   301 -SAVLLMNVVDDVTRRSDL--KMGDLLREFSHLELVKRD----FHLQLELFSDHLRCHPSTYKVC 358
             :.||||...|...|:|::  |:        .|::|..|    :...:|.|...|:......||.
  Fly   319 ANLVLLMMCADYTVRQSEVPKKL--------PLDIVCSDMDERWDKSVETFLGQLQTQRLEIKVL 375

  Fly   359 GLFIFNKQTSLAYFFYVLVQVLVLVQF----------DLKNKVE 392
            |.|..|.:..|.....::..:.:|:||          |:||:.:
  Fly   376 GFFHLNNEFILLILSAIISYLFILIQFGITGGFEASEDIKNRFD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 73/403 (18%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 67/388 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.