DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr23a

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:156 Identity:37/156 - (23%)
Similarity:61/156 - (39%) Gaps:43/156 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GGLLTVLPFTFPHYMYDDSYMSSNPVLKWTFNLTNI-TRIMAMFSGVLLMWFRRKRILNLGENLI 106
            |.|||::...|..:: .:||        |.|  .:| ||...:::.:|.:.|    |.|:...:.
  Fly   233 GSLLTIIIVHFAIFV-SNSY--------WLF--VDIRTRPWRIYAILLNLGF----IFNVALQMA 282

  Fly   107 LHCLKCKTLDNRSKK----YSKLRKRVRNVLFQMLLVANLSILLGALILFRIHSVQRISKTA--- 164
            ..|..|:...|..::    .|||.|...:.|:.. ||:..|       |..:|  ||...||   
  Fly   283 AACWHCQQSYNLGRQIGCLISKLVKPQGSKLYND-LVSEFS-------LQTLH--QRFVVTAKDF 337

  Fly   165 ----------MIVAHITQFIYVVFMM 180
                      |..|.:|..:.::..|
  Fly   338 FSLNLHLLSSMFAAVVTYLVILIQFM 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 37/156 (24%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 36/153 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.