DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr9a

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:324 Identity:65/324 - (20%)
Similarity:123/324 - (37%) Gaps:99/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DNRS--KKYSKLRKRVRNVLFQMLLVANLSILLGALILFR-----IHSVQRISKTAMIVAHITQF 173
            ||.|  ..::|:...| |:.::|:   :..|.|.||...|     :..:..:..|:.|..|:   
  Fly    57 DNESVPAYFAKVIMGV-NMAYKMI---HAWIALSALFECRRFRYLLEELPPVKATSFIYRHL--- 114

  Fly   174 IYVVFMMTGICVILLVLHWQSERLQIALKDLCSFLNHEERNSLTLSENKA---------NRSLGK 229
              ::.::...|...|||...:.| .|.|::|        |.:.:|...:|         :|..||
  Fly   115 --ILEIILFACNAFLVLSEYTIR-GIYLENL--------RYAYSLQAVRARYLQMMVLVDRLDGK 168

  Fly   230 LAKL----------FKL----FAENQRLVREVFRTFDLPIALLLLKMFVTNVNLVYHGVQFGNDT 280
            |.:|          :|.    :|...::.|.:...|.|  :||||.:.                 
  Fly   169 LEQLHHRVISGSSDYKTLRLDYAHLAKVTRSLSHLFGL--SLLLLNVL----------------- 214

  Fly   281 IETSSYTRIVGQWVVISHYWSAVLLMNV----------VDDVTRRSDLKMGDL-------LREFS 328
                    .:|.|:::.:.:..|..:.|          |..|...:.:|:..:       :.:..
  Fly   215 --------CLGDWIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIWSICAASHRCVSKSK 271

  Fly   329 HLELVKRDF-------HLQLELFSDHLRCHPSTYKVCGLFIFNKQTSLAYFFYVLVQVLVLVQF 385
            ||:...:|.       ..|:|.|:..:...|....|||::..|.||....||::|..:::.:||
  Fly   272 HLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 60/310 (19%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 63/322 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.