DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr2a

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001162633.1 Gene:Gr2a / 31093 FlyBaseID:FBgn0265139 Length:428 Species:Drosophila melanogaster


Alignment Length:456 Identity:93/456 - (20%)
Similarity:168/456 - (36%) Gaps:137/456 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CGLMP---APLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTFPHY-MYDDSYMSSNPVLKWTF 73
            |.|.|   ||....:.:|..:.||..:|     |..:.:...:|..| ::.:|.:......:.|.
  Fly    17 CNLWPWRLAPPPDSEGILLRRSRWLELY-----GWTVLIAATSFTVYGLFQESSVEEKQDSESTI 76

  Fly    74 NLTNIT---------RIMAMFSGVLLMWFRRKR---ILNLGE--NLILHCLKCKTLDNRSKKYSK 124
            :....|         |:..:.:.:..:|.|:.:   ...|||  .|:...|:   :|..:.:.:.
  Fly    77 SSIGHTVDFIQLVGMRVAHLAALLEALWQRQAQRGFFAELGEIDRLLSKALR---VDVEAMRINM 138

  Fly   125 LRKRVRNVLFQM--LLVANLSILLGALIL-----FRIHSVQRISKTAMIVAHITQFIYVVFMMTG 182
            .|:..|..::.:  ..|:.| ::|||.:|     |.|:.:..:  ..::|..:..|  .:|..|.
  Fly   139 RRQTSRRAVWILWGYAVSQL-LILGAKLLSRGDRFPIYWISYL--LPLLVCGLRYF--QIFNATQ 198

  Fly   183 ICVILLVLHWQSERLQIALKDLCSFLNHEERNSL-TLSENKANRSLGKLAKLFKLFAENQRLVRE 246
            :.         .:||.:.|..|.....|::..:: |:.|.:.:.....:.:|.        .||.
  Fly   199 LV---------RQRLDVLLVALQQLQLHQKGPAVDTVLEEQEDLEEAAMDRLI--------AVRL 246

  Fly   247 VFRTFDLPIALLLLKMFVTNVNLVYHG----VQFGND--TIETSSYTRIVGQW------------ 293
            |::.....:|||         |..| |    :|.|||  .|.::.|      |            
  Fly   247 VYQRVWALVALL---------NRCY-GLSMLMQVGNDFLAITSNCY------WMFLNFRQSAASP 295

  Fly   294 -----VVISHYWSA-----VLLMNVVDDVTRRSDLKMG--------DLLREFSHLELVK------ 334
                 :|.|..|||     ||:::::.|.|.:...::.        ||..| ||..||.      
  Fly   296 FDILQIVASGVWSAPHLGNVLVLSLLCDRTAQCASRLALCLHQVSVDLRNE-SHNALVGTLVRYC 359

  Fly   335 -----------RDFHLQLELFSDHLRCHPSTYKVCGLFIFNKQTSLAYFFY--VLVQVLVLVQFD 386
                       ..|.|||.    |.|.|   :...|  .||...:|.|...  ....:::|:||.
  Fly   360 APLIILVPLQITQFSLQLL----HQRLH---FSAAG--FFNVDCTLLYTIVGATTTYLIILIQFH 415

  Fly   387 L 387
            :
  Fly   416 M 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 90/438 (21%)
Gr2aNP_001162633.1 7tm_7 7..418 CDD:285581 93/456 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.