DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr36b

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:427 Identity:89/427 - (20%)
Similarity:183/427 - (42%) Gaps:83/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLLK--FMYIYGIGCGLMPAPLKKGQFLLGYKQRWYLIYTACLHGGLLTVLPFTFPHYMYDDS-- 61
            :|||  .:|.|.||........:.|:.   :|.|...||....:..:|..:.:.|.  .:.|:  
  Fly     7 LLLKAVHIYCYLIGLSNFEFDCRTGRV---FKSRRCTIYAFMANIFILITIIYNFT--AHGDTNL 66

  Fly    62 -YMSSNPVLKWTFNLTNITRIMAMFSGVLLMWFRRKRILNLGENLILHCLKCKTLDNRSKKYSKL 125
             :.|:|.:.::...:.:..:|:|....||..|.:|.:::.|.:::|                   
  Fly    67 LFQSANKLHEYVIIIMSGLKIVAGLITVLNRWLQRGQMMQLVKDVI------------------- 112

  Fly   126 RKRVRNVLFQMLLVANLSILLGALILFRIH------SVQRISK--TA----MIVAHITQFIYVVF 178
              |:..:..|:..:....|||.|.|.|.|.      ||..:.:  ||    ::|.....||..:.
  Fly   113 --RLYMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLA 175

  Fly   179 MMTGICVILLV---LHWQSERLQIALKD--LCSFLNHEERNSLT----LSENKANRSLGKLAKLF 234
            :.....||||:   ....:.:|::.:::  ..|||.......:|    ||:        :|..:.
  Fly   176 ISQHFLVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRNGAFMTRCCYLSD--------QLEDIG 232

  Fly   235 KLFAENQRLVREVFRTFDLPIALLLLKMFVTNVN---LVYHGVQFGNDTIETSSYTRIVGQWVVI 296
            ::.::.|.:|.::...|.:...:...:.:::.|.   :.|...::|...::.|:.|.|:...::.
  Fly   233 EVQSQLQSMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILIT 297

  Fly   297 SHYWSAVL----LMNVVDDVTRRSDLKMGDLLRE----FSHLEL-VKRDFH-LQLELFSDHLRCH 351
            ..|..|::    ::.|:|   ...|. :| ||.|    .|.|:: ::..|. |||:|..:.|:.:
  Fly   298 LFYLDALVNCNNMLRVLD---HHKDF-LG-LLEERTVFASSLDIRLEESFESLQLQLARNPLKIN 357

  Fly   352 PSTYKVCGLFIFNKQTSLAYFFYVLVQVLVLVQFDLK 388
                 |.|:|...:.::.|....|:|..:.|:|||::
  Fly   358 -----VMGMFPITRGSTAAMCASVIVNSIFLIQFDME 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 82/408 (20%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 88/425 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.