DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr58a and Gr92a

DIOPT Version :9

Sequence 1:NP_726135.2 Gene:Gr58a / 117344 FlyBaseID:FBgn0041239 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:399 Identity:69/399 - (17%)
Similarity:143/399 - (35%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 HYMYDDSYMSSNPVLKW---TFNLTNITRIMAMFSGVLLMWFRRKRILNL--GENLIL------- 107
            |...||..:.....|||   |..:...||...::  :..:..:..|:|.:  |..|:|       
  Fly    36 HTRKDDKTVFIRNWLKWLNVTHRIITFTRFFWVY--IASISIKTNRVLQVLHGMRLVLSIPNVAV 98

  Fly   108 ----HCLKCKTLDNRSKKYSKLRKRVRNVLFQ------------MLLVANL-------------- 142
                |..:...:.:...::.:|.::|.: ||:            :|::.||              
  Fly    99 ILCYHIFRGPEIIDLINQFLRLFRQVSD-LFKTKTPGFGGRRELILILLNLISFAHEQTYLWFTI 162

  Fly   143 ---------------SILLGALILF-RIHSVQRISKTAMIVAHITQFIYVVFMMTGICVILLVLH 191
                           ..|:.|..:| .|:|:..:| ..::.:.:.:::|.               
  Fly   163 RKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLS-LGVLYSELNKYVYT--------------- 211

  Fly   192 WQSERLQIALKDLCSFLNHEERNSLTLSENKANRSLGKLAKLFKLFAENQRLVREVFRTFDLPIA 256
                .|:|.|:.|          :.:.|:.|..|...:|.|...|:       ||::.|     :
  Fly   212 ----NLRIQLQKL----------NTSGSKQKIRRVQNRLEKCISLY-------REIYHT-----S 250

  Fly   257 LLLLKMFV--TNVNLVYHGVQFG----NDTIETSSYTRIVGQWVVISHYWSAVLLMNVVDDVTRR 315
            ::..|:||  ..:.|:|..:...    |..:|  .|......|:::..:...:.|:.|..:....
  Fly   251 IMFHKLFVPLLFLALIYKVLLIALIGFNVAVE--FYLNSFIFWILLGKHVLDLFLVTVSVEGAVN 313

  Fly   316 SDLKMGDLLREFSHL-ELVKRDFHLQLELFSDHLRCHPSTYKVCGLFIFNKQTSLAYFFYVLVQV 379
            ..|.:|   .:|.:: :|.|  |...|:....|||.......:.|||...:...|.:...:|..:
  Fly   314 QFLNIG---MQFGNVGDLSK--FQTTLDTLFLHLRLGHFRVSILGLFDVTQMQYLQFLSALLSGL 373

  Fly   380 LVLVQFDLK 388
            ..:.|:.::
  Fly   374 AFIAQYRMQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr58aNP_726135.2 7tm_7 3..373 CDD:285581 67/382 (18%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 69/397 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.