DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr98a

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:282 Identity:61/282 - (21%)
Similarity:99/282 - (35%) Gaps:87/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LIFALLLYQTMRKSVVNVMWKYANSLHEYVFLV-IAGFRVVC-----VFLELVSRWSQ-----RR 102
            |||.::...:.|...:|..:.      |.|||. .:.|.:.|     ::.||:...|.     .|
  Fly   141 LIFIVVTIYSNRALTINATYS------ELVFLARFSEFTLYCAVILFIYQELIVGGSNVLDELYR 199

  Fly   103 TFVRLFNSFRRLYQRNPDIIQYCRRSIVSKFFCVTMTETLHIIVTLAMMRNRLSIALALRIWAVL 167
            |...:: |.|||..:....:|....|:.....|:.....|.:|..|  |:..:..: ||..|..|
  Fly   200 TRYEMW-SIRRLSLQKLAKLQAIHNSLWQAIRCLECYFQLSLITLL--MKFFIDTS-ALPYWLYL 260

  Fly   168 SLTAIINVIITQYYVATA-CVRGRYALLNKDLQAIVTESQSLVPNGGGVFVTKCCYLADRLERIA 231
            |......|.: |:||||. |::    ||           :.:||          |||..|.:.:.
  Fly   261 SRVEHTRVAV-QHYVATVECIK----LL-----------EIVVP----------CYLCTRCDAMQ 299

  Fly   232 KS-------------QSDLQELVENLSTAYEGEVVCLVITYYLNMLGTSYLLFSISKYGNFGNNL 283
            :.             .|.|...:.:|:                       |..|..||......:
  Fly   300 RKFLSMFYTVTTDRRSSQLNAALRSLN-----------------------LQLSQEKYKFSAGGM 341

  Fly   284 LVIIT-LCGIVYF--VFYVVDC 302
            :.|.| :.|..:|  :.|:|.|
  Fly   342 VDINTEMLGKFFFGMISYIVIC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 61/282 (22%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 61/282 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.