DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr59f

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:392 Identity:72/392 - (18%)
Similarity:142/392 - (36%) Gaps:112/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LISVSTHLLIFALLLYQTMRKSVVNVMWKYA------NSLHEYVFLVIAGFRVVCVFLELVSRWS 99
            |:.:|..:|.:.|.        |:...|::.      .||..|:..:.:...||.:|..::..|.
  Fly    65 LVHLSWMILWYGLF--------VLGSYWEFVLVTTQRVSLDRYLNAIESAIYVVHIFSIMLLTWQ 121

  Fly   100 QRRTFVRLF-----NSFRRLYQRNPDIIQYCRRS---------IVSKFFCVTMTETLHIIVTLAM 150
            .|....:|.     :...|.|..:      |.|:         :|..|.|               
  Fly   122 CRNWAPKLMTNIVTSDLNRAYTID------CNRTKRFIRLQLFLVGIFAC--------------- 165

  Fly   151 MRNRLSIALALRIW--------AVLSLTAII--NVI----ITQYYVATACVRGRYALLNKDLQAI 201
                  :|:...||        ::||:.:.:  |:|    ..|||:....:..|...|.:.|:..
  Fly   166 ------LAIFFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRRLTEGLERE 224

  Fly   202 VTESQSLVPNGGGVFVTKCCYLADRLERIAKSQSDLQELVENLSTAYEGEVVCLVITYYLNMLGT 266
            :|...|  |.            ...:::|....::|.:..:.::..::..::.|.:..:||.   
  Fly   225 LTHLHS--PR------------ISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNF--- 272

  Fly   267 SYLLFSISKYGNFGNNLLVIIT--LCGIVYFVFYVVD-CWINAFNVFYLLDAHDKMVKLLNK--- 325
            :.:||.:  |....|..:...|  :|.:::...:|.. |.|..||. .:.:.|...:.||::   
  Fly   273 NLVLFLV--YQGIENPSMADFTKWVCMLLWLAMHVGKVCSILHFNQ-SIQNEHSTCLTLLSRVSY 334

  Fly   326 -RTLFQPGLDHRLEMVFENFALNLVRNPLKLHMYGLFEFGRGTSFAVFNSLLTHS----LLLIQY 385
             |...|..:.|.:..:..|...::|...:.|.:..|            .:||..|    :.|:||
  Fly   335 ARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFL------------TTLLVASADFFIFLLQY 387

  Fly   386 DV 387
            ||
  Fly   388 DV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 72/392 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 69/389 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.