DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr59e

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:294 Identity:58/294 - (19%)
Similarity:96/294 - (32%) Gaps:115/294 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 SIALALRIWA-----VLSLTAIINVIITQYY-------VATACVRGRYALLNKDLQAIVTESQSL 208
            |:.|.:.||.     .|..|..|..|....|       :||..:...||:||:.|          
  Fly    36 SLFLLMYIWTGSIVKCLEFTVEIPTIEKLLYLMEFPGNMATIAILVYYAVLNRPL---------- 90

  Fly   209 VPNGGGVFVTKCCYLADRLERIAKSQSDLQELVENLSTAYEGEVVCLVITYY----LNMLGTSYL 269
             .:|                      ::||  :|.:.|..:|:...||...:    |:::.|:  
  Fly    91 -AHG----------------------AELQ--IERIITGLKGKAKRLVYKRHGQRTLHLMATT-- 128

  Fly   270 LFSISKYGNFGNNLLVIITLCGIVYFVFYVVDCWI-----NAFN----------------VFYLL 313
                          ||...||.:|..|.|..:.|.     :.:|                |.:|.
  Fly   129 --------------LVFHGLCVLVDVVNYDFEFWTTWSSNSVYNLPGLMMSLGVLQYAQPVHFLW 179

  Fly   314 DAHDKMVKLLNKRTLFQ--PGLDHRLEMVFEN--------------------FALNLVRNPLKLH 356
            ...|:|...|.:..|.|  |....:|:..:|:                    :..||:.   ::|
  Fly   180 LVMDQMRMCLKELKLLQRPPQGSTKLDACYESAFAVLVDAGGGSALMIEEMRYTCNLIE---QVH 241

  Fly   357 MYGLFEFGRGTSFAVFNSLLTHSLLLIQYDVQNF 390
            ...|..||......:.|||:  |:.:..|.:.||
  Fly   242 SQFLLRFGLYLVLNLLNSLV--SICVELYLIFNF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 56/291 (19%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 58/294 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.