DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr57a

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:348 Identity:69/348 - (19%)
Similarity:128/348 - (36%) Gaps:109/348 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RLTGVINFKIDLKTGQALVTR---GATLISVST----HLLIF---------------ALLLYQTM 59
            ||....|..:.:...:.|::.   |.|:||:..    ||.|:               |.|.|:.|
  Fly    76 RLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHLGIYQRLAALDARLMSDFGANLNYRKM 140

  Fly    60 -RKSVV---NVMWKYANSLHEYVFLVIAGFRVVCVFLEL----VSRWSQRRTFVRL--------- 107
             ||::.   .|...|..:::.....|.:|.|.:.:...|    |:.......:|.:         
  Fly   141 LRKNIAVLGIVTTIYLMAINSAAVQVASGHRALFLLFALCYTIVTGGPHFTGYVHMTLAEMLGIR 205

  Fly   108 FNSFRRLYQ------RNPDI-IQYCR-RSIVSKFFCVTMTETLHIIVTLAMMRNRLSIALALRIW 164
            |...::|.|      |.|.: :|..| |.:||      |.:.||.::      ..::...||.:|
  Fly   206 FRLLQQLLQPEFLNWRFPQLHVQELRIRQVVS------MIQELHYLI------QEINRVYALSLW 258

  Fly   165 AVLS-----LTAIINVIITQY-------------------YVATACVRGRYALLNKDLQAIVTES 205
            |.::     .|:.:.::..|.                   |:|...:...|.||........|..
  Fly   259 AAMAHDLAMSTSELYILFGQSVGIGQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIY 323

  Fly   206 QSLVPNGGGVFVTKCCYLADRLERIAKSQSDLQELVENL-STAYEGEV-----VCLVITYYLNML 264
            ::          .:|..|.::|:.....:|.|:.|||:| |...:.::     :.:|::..:..|
  Fly   324 EA----------RRCLRLVEKLDDWFPQKSSLRPLVESLMSWRIQAKIQFTSGLDVVLSRKVIGL 378

  Fly   265 GTSYLLFSISKYGNFGNNLLVII 287
            .||.|:          |.||::|
  Fly   379 FTSILV----------NYLLILI 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 69/348 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 69/348 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.