DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr9a

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:346 Identity:69/346 - (19%)
Similarity:128/346 - (36%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SLHEYVFLVIAG----FRVVCVFLELVSRWSQRRTFVRLFNSFRRLYQRNPDIIQYCRRSIVSKF 133
            |:..|...||.|    ::::..::.|.:.:..||        ||.|.:..|.:   ...|.:.: 
  Fly    60 SVPAYFAKVIMGVNMAYKMIHAWIALSALFECRR--------FRYLLEELPPV---KATSFIYR- 112

  Fly   134 FCVTMTETLHIIVTLAMMRNRLSIALALRIWAVLSLTAIINVII--TQYYVATACVRGRYALLNK 196
                     |:|:.:        |..|...:.|||...|..:.:  .:|..:...||.||     
  Fly   113 ---------HLILEI--------ILFACNAFLVLSEYTIRGIYLENLRYAYSLQAVRARY----- 155

  Fly   197 DLQAIVTESQSLVPNGGGVFVTKCCYLADRLE--------RIAKSQSDLQELVENLSTAYEGEVV 253
             ||.:|                    |.|||:        |:....||.:.|  .|..|:..:| 
  Fly   156 -LQMMV--------------------LVDRLDGKLEQLHHRVISGSSDYKTL--RLDYAHLAKV- 196

  Fly   254 CLVITYYL-NMLGTSYLLFSISKYGNFGNNLLVIITLCGIVYFVFYV---------------VDC 302
                |..| ::.|.|.||.::...|::       |.:|.:.:.|.|:               |.|
  Fly   197 ----TRSLSHLFGLSLLLLNVLCLGDW-------IIVCNVYFMVAYLQVLPATLFLFGQVMFVVC 250

  Fly   303 WINAFNVFYLLDAHDKMV---KLLNKRTLFQPGLDHRLEMVFENFALNLVRNPLKLHMYGLFEFG 364
             .....::.:..|..:.|   |.|.::....||.........|.|||.::::|:::.:.|::...
  Fly   251 -PTLIKIWSICAASHRCVSKSKHLQQQLKDLPGQTPVERSQIEGFALQIMQDPIQIDVCGIYHLN 314

  Fly   365 RGTSFAVFNSLLTHSLLLIQY 385
            ..|...:|..:|...::.:|:
  Fly   315 LQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 69/346 (20%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 68/344 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.