DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr93d

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster


Alignment Length:311 Identity:62/311 - (19%)
Similarity:121/311 - (38%) Gaps:95/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VSTHLLIFALLLYQTMRKS-----------VVNVMWKYANSLHEYVFLVIAGFRVVCVFLELVSR 97
            |:.:|.||.|......|:|           :::|..:    :|||||:::...| :|.|..::  
  Fly   112 VNQYLHIFRLGTLDIRRRSQFGGGRELFLLILSVCCQ----IHEYVFILVIASR-LCGFQHII-- 169

  Fly    98 WSQRRTFVRLF-NSFR-----------RLYQRNPDIIQYCRRSIVSKFFCVTMTETLHIIVTLAM 150
            |....|:|.:. ||..           .||....|.::: .....:.|  :...:.:.:..::|:
  Fly   170 WWVSYTYVFIICNSIMCFGFIWHLSLGVLYAELNDNLRF-ESGFQTAF--LRKQQRIRVQKSMAL 231

  Fly   151 MRNRLSIALALR----IWAVLS-LTAIINVIITQYYVATACVRGRYALLNKDLQAIVTESQSLVP 210
            .:...|:..:|:    :...|| |..::.|::..|.:........:.:.:..|:.::   |:|:|
  Fly   232 FKEISSVVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFSDFRIWSFSLKNLI---QTLLP 293

  Fly   211 NGGGVFVTKCCYLADRLERIAKSQSDL---------QELVE------NLSTAYEGEVVCLVITYY 260
                  |......|::.::..:...|:         .:.||      |||            .:.
  Fly   294 ------VLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLS------------EFR 340

  Fly   261 LNMLGTSYLLFSISKYGNFGNNL-----------LVIITLCGIVYFVFYVV 300
            :|:||    ||::|      |.|           ||.:|.|.|||...||:
  Fly   341 VNLLG----LFNVS------NELFLIIVSAMFCYLVFVTQCVIVYRRRYVI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 62/311 (20%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 58/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.