DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr59d and Gr39a

DIOPT Version :9

Sequence 1:NP_611758.2 Gene:Gr59d / 117343 FlyBaseID:FBgn0041236 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:375 Identity:80/375 - (21%)
Similarity:150/375 - (40%) Gaps:66/375 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SVSTHLLIFALLLYQTMRKSVVNVMWK---------YANSLHEYVFLVIAGFRVVCVFLELVSRW 98
            ||..:::.|||..|.....||:...|:         ..|.....|.::..|..||          
  Fly    37 SVLCYIVHFALQAYLVGCISVMVTYWRRCFKSELTTTGNHFDRLVMVIALGILVV---------- 91

  Fly    99 SQRRTFVRLFNSFRRLYQRNPDIIQYCRRSIVSKFFCVTMTETLHIIV--TLAMMRNRLSIAL-- 159
             |....:.|.....|:.::    |::.||:.::....:.....|.:|:  .:..|.|.:...:  
  Fly    92 -QNAWLIWLQAPHLRIVRQ----IEFYRRNHLANVRLLLPKRLLWLIIATNVVYMANFIKTCIFE 151

  Fly   160 ----ALRIWAVLSLTAIINVIITQYYVAT-ACVRGRYALL----NKDLQAIVTESQSL---VPNG 212
                |.|::.:.||...:..::|.:.:.| .|:.....|:    ...:.||:.||..|   .|| 
  Fly   152 WLTDASRLFVITSLGFPLRYLVTSFTMGTYFCMVHIVRLVLDWNQSQINAIIDESADLKMTSPN- 215

  Fly   213 GGVFVTKCCYLADRLERIAKSQSDLQELVENLSTAYEGEVVCLVITY-YLNMLGTSYLLFSISKY 276
             .:.:..|..:.|||..:..         :.:|..| |.:..|...: .|::.|..||...|.. 
  Fly   216 -RLRLRVCLEMHDRLMLLCN---------DEISLVY-GFIAWLSWMFASLDVTGVIYLTMVIQT- 268

  Fly   277 GNFGNNLLVIITLCGIVYFVFYVVDCWINAFNVFYLLDAHDKMVKLLNKRTLFQPGLDHRLEMVF 341
                ...:|:..:..:|:.....:.|..:..:....:.| :|..|:|.|......|||.    :.
  Fly   269 ----KKSIVLKLITNVVWLSPTFMTCAASFMSNRVTIQA-NKTAKMLTKVPRTGTGLDR----MI 324

  Fly   342 ENFAL-NLVRNPLKLHMYGLFEFGRGTSFAVFNSLLTHSLLLIQY-DVQN 389
            |.|.| ||.:.|: |..||.|...:.|.|.:|.::.|:.::|:|: :::|
  Fly   325 EKFLLKNLRQKPI-LTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEMEN 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr59dNP_611758.2 7tm_7 9..389 CDD:285581 79/373 (21%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 79/372 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.