DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr94a and Gr93a

DIOPT Version :9

Sequence 1:NP_732816.1 Gene:Gr94a / 117339 FlyBaseID:FBgn0041225 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:416 Identity:94/416 - (22%)
Similarity:167/416 - (40%) Gaps:95/416 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RAGRRERFRF----SKANLAFASLWAIAFSLVYGRQIYKEYQEGQINLKDATTLYSYMNITV-AV 94
            :.|.|.||..    ....:.:|.||.:..|.|.|::: :.|       .|...|...|:::: ||
  Fly    49 KQGSRNRFLHILWRCIVVMIYAGLWPMLTSAVIGKRL-ESY-------ADVLALAQSMSVSILAV 105

  Fly    95 INYVSQMIISDHVAKVLSKVPFFDTLKEFRLDSRSLYISIVLALVKTVAFPLTIEVAFILQQRRQ 159
            |::|.|....:...:||::.             .:||..|.|.......||....|.|:|:    
  Fly   106 ISFVIQARGENQFREVLNRY-------------LALYQRICLTTRLRHLFPTKFVVFFLLK---- 153

  Fly   160 HPEMSLIWTLYRLFPLIISNFLNN---------------------------CYFGAMVVVKEILY 197
                 |.:||...|..||..|.|:                           |:.|  .:|..|||
  Fly   154 -----LFFTLCGCFHEIIPLFENSHFDDISQMVGTGFGIYMWLGTLCVLDACFLG--FLVSGILY 211

  Fly   198 A-LNRRLEAQLQEVNLLQRKDQLKLYTKYYRMQRFCALADELDQLAYRYRLIYVHSGKYLTPMSL 261
            . :...:.|.|:.:..::.:|:....|||.|||..|..|||||:.|..|..:|..:..:...:..
  Fly   212 EHMANNIIAMLKRMEPIESQDERYRMTKYRRMQLLCDFADELDECAAIYSELYHVTNSFRRILQW 276

  Fly   262 SMILSLICHLLGITVGFYS--LYYAIADTLIMGKPYDGLGSLINLVFLSISLAEITLLTHLCNHL 324
            .::..:..:.:.|.:..|.  |::...|.::          .:::|...:.||.:.||....:: 
  Fly   277 QILFYIYLNFINICLMLYQYILHFLNDDEVV----------FVSIVMAFVKLANLVLLMMCADY- 330

  Fly   325 LVATRRSAVILQEMNL----QHADSRYRQAVHGFTLLVTVTKYQIKPLGLYELDMRLISNVFSAV 385
               |.|.:.:.:::.|    ...|.|:.::|..|...:...:.:||.||.:.|:...|..:.||:
  Fly   331 ---TVRQSEVPKKLPLDIVCSDMDERWDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAI 392

  Fly   386 ASFLLILVQ----------ADLSQRF 401
            .|:|.||:|          .|:..||
  Fly   393 ISYLFILIQFGITGGFEASEDIKNRF 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr94aNP_732816.1 7tm_7 19..399 CDD:285581 92/412 (22%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 91/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.