DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr94a and Gr68a

DIOPT Version :9

Sequence 1:NP_732816.1 Gene:Gr94a / 117339 FlyBaseID:FBgn0041225 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:425 Identity:85/425 - (20%)
Similarity:161/425 - (37%) Gaps:103/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VFGLLANRYRAGRRERFRFSKANLAFASLWAIAF---SLVYGRQIY---KEYQ-----EG---QI 76
            :|.:|. .|.....:.|||......:..|.|:..   ||..|..:.   |||:     :|   :|
  Fly    16 IFAILP-FYSGDVDDGFRFGGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEI 79

  Fly    77 NLKDATTLYSYMNITVAVINYVSQMIISDHVAKVLSKVPFFDTLKEF-RLDS-------RSLYIS 133
            | :...||...::.|:.|::.|..  .|.|          |.||.:. ::|.       |..|..
  Fly    80 N-RTIETLLCIISYTMVVLSSVQN--ASRH----------FRTLHDIAKIDEYLLANGFRETYSC 131

  Fly   134 IVLALVKTVAFPLTIEVAFI-------LQQRRQHPEMSLIWTLYRLFPLIISNFLNNCYFGAMVV 191
            ..|.::.|.|....:.|||.       :..:|| ..:.||:.|..|:..:::.:|..    .|:.
  Fly   132 RNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQ-IILLLIYFLQLLYSTLLALYLRT----LMMN 191

  Fly   192 VKEILYALNRRLEA-QLQEVNLLQRKDQLKLYTKYYRMQRFCALADELDQLA-YRY--------- 245
            :.:.:..||::|:. .||:..               .|:.:..|::.::.|. :||         
  Fly   192 LAQRIGFLNQKLDTFNLQDCG---------------HMENWRELSNLIEVLCKFRYITENINCVA 241

  Fly   246 --RLIYVHSGKYLTPMSLSMILSLICHLLGITVGFYSLYYAIADTLIMGKPYDGLGSLINLVFLS 308
              .|::.....:.|..:.|.:.     ...:|.|..|....:|||:       ||    :.:::.
  Fly   242 GVSLLFYFGFSFYTVTNQSYLA-----FATLTAGSLSSKTEVADTI-------GL----SCIWVL 290

  Fly   309 ISLAEITLLTHLCNHLLVATRRSAVILQEMNLQHADSRYRQAVHGFTLLVTVTKYQIKPLGLYEL 373
            .....:.::...|:.|......:|.||  ..:.....:::..:..|.........|....|.:.:
  Fly   291 AETITMIVICSACDGLASEVNGTAQIL--ARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSI 353

  Fly   374 DMRLISNVFSAVASFLLILVQ---------ADLSQ 399
            |...:..:||||.::|:||:|         .|:||
  Fly   354 DNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDISQ 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr94aNP_732816.1 7tm_7 19..399 CDD:285581 83/423 (20%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 82/414 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.