DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr94a and Gr66a

DIOPT Version :9

Sequence 1:NP_732816.1 Gene:Gr94a / 117339 FlyBaseID:FBgn0041225 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_523971.3 Gene:Gr66a / 38935 FlyBaseID:FBgn0035870 Length:527 Species:Drosophila melanogaster


Alignment Length:480 Identity:90/480 - (18%)
Similarity:162/480 - (33%) Gaps:152/480 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ERFRF------SKANLAFASLWAIAFSLVYGRQIYKEYQEGQINLKDATTLYSYMNITVAVINYV 98
            |:||.      |:..:.:.....|.:.::|...||...:|.:......:||...:.:.:..|..:
  Fly    33 EKFRSRNLLEKSRNGMIYMLSTLILYVVLYNILIYSFGEEDRSLKASQSTLTFVIGLFLTYIGLI 97

  Fly    99 SQMIISDHVAKVLSKVPFFDTLKEFRLDSRSLYIS------------IVLALVKTVAFPLTIEVA 151
              |::||.:..:.::....:..:..||....||..            |.:.|:.||.|.|:|.|:
  Fly    98 --MMVSDQLTALRNQGRIGELYERIRLVDERLYKEGCVMDNSTIGRRIRIMLIMTVIFELSILVS 160

  Fly   152 FILQQRRQHPEMSLIWTLYRLFPLIISNFLNNCYFGAMVVVKEILYALNRRLE---AQLQEVNLL 213
            ..::.......|||:| :....|..| |.|:..:|...      ||||..|.|   |.|:|  |:
  Fly   161 TYVKLVDYSQWMSLLW-IVSAIPTFI-NTLDKIWFAVS------LYALKERFEAINATLEE--LV 215

  Fly   214 QRKDQLKLYTK-----------------------YY----------------------------- 226
            ...::.||:.:                       .|                             
  Fly   216 DTHEKHKLWLRGNQEVPPPLDSSQPPQYDSNLEYLYKELGGMDIGSIGKSSVSGSGKNKVAPVAH 280

  Fly   227 ---------------------------------------RMQRFCALADELDQLAYRYRLIYVHS 252
                                                   ::...|.:.||:.::           
  Fly   281 SMNSFGEAIDAASRKPPPPPLATNMVHESELGNAAKVEEKLNNLCQVHDEICEI----------- 334

  Fly   253 GKYLTPMSLSMILSLICH-LLGITVGFYSLYYAIADTLIMGKPYDGLGSL--------INLVFLS 308
            ||.|..:....||||:.: .|..|...|.||.|        ..|..:.||        |.::.||
  Fly   335 GKALNELWSYPILSLMAYGFLIFTAQLYFLYCA--------TQYQSIPSLFRSAKNPFITVIVLS 391

  Fly   309 ISLAEITLLTHLCNHLLVATRRSAVILQEMNLQHADSRYRQAVHGFTLLVTVTKYQIKPLGLYEL 373
            .:..:...|.:|......|::|:.:.|.:..:...|:...:.|:..:|.:..........|.:.|
  Fly   392 YTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADDNLLYEIVNHLSLKLLNHSVDFSACGFFTL 456

  Fly   374 DMRLISNVFSAVASFLLILVQADLS 398
            ||..:..|...:.|:|:||:|.:|:
  Fly   457 DMETLYGVSGGITSYLIILIQFNLA 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr94aNP_732816.1 7tm_7 19..399 CDD:285581 90/480 (19%)
Gr66aNP_523971.3 7tm_7 21..478 CDD:285581 88/475 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.