DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr94a and Gr97a

DIOPT Version :9

Sequence 1:NP_732816.1 Gene:Gr94a / 117339 FlyBaseID:FBgn0041225 Length:404 Species:Drosophila melanogaster
Sequence 2:NP_001287551.1 Gene:Gr97a / 117338 FlyBaseID:FBgn0041224 Length:425 Species:Drosophila melanogaster


Alignment Length:403 Identity:154/403 - (38%)
Similarity:237/403 - (58%) Gaps:13/403 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HRRMVKFLTIILIGFMTVF-----GLLANRYRAGRRERFRFSKANLAFASLWAIAFSLVYGRQIY 68
            |.::|   ||.|  :.|||     |:...|: :.||::|.|||....::...|..|:|.|...||
  Fly    29 HTQLV---TICL--YATVFLNILYGVYLGRF-SFRRKKFVFSKGLTIYSLFVATFFALFYIWNIY 87

  Fly    69 KEYQEGQINLKDATTLYSYMNITVAVINYVSQMIISDHVAKVLSKVPFFDTLKEFRLDSRSLYIS 133
            .|...|||||:|...:|.|||:.|.:.|||:|...:..:.:..:.||.|..|....:.:..::.:
  Fly    88 NEISTGQINLRDTIGIYCYMNVCVCLFNYVTQWEKTLQIIRFQNSVPLFKVLDSLDISAMIVWRA 152

  Fly   134 IVLALVKTVAFPLTIEVAFILQQRR--QHPEMSLIWTLYRLFPLIISNFLNNCYFGAMVVVKEIL 196
            .:..|:|.|..||...:..||..||  ...:.:.:.|...:.|||:||.:|||:||.:|:...|.
  Fly   153 FIYGLLKIVFCPLITYITLILYHRRSISESQWTSVTTTKTMLPLIVSNQINNCFFGGLVLANLIF 217

  Fly   197 YALNRRLEAQLQEVNLLQRKDQLKLYTKYYRMQRFCALADELDQLAYRYRLIYVHSGKYLTPMSL 261
            .|:||:|...::|.|:||...|:.|:..||||:|||.|||.||:||.:|......|..||.....
  Fly   218 AAVNRKLHGIVKEANMLQSPVQMNLHKPYYRMRRFCELADLLDELARKYGFTASRSKNYLRFTDW 282

  Fly   262 SMILSLICHLLGITVGFYSLYYAIADTLIMGKPYDGLGSLINLVFLSISLAEITLLTHLCNHLLV 326
            ||:||::.:|||||:|.|:.|.||||..|..:|:|...:::.:|||::...|:.::..:.|..||
  Fly   283 SMVLSMLMNLLGITMGCYNQYLAIADHYINEEPFDLFLAIVLVVFLAVPFLELVMVARISNQTLV 347

  Fly   327 ATRRSAVILQEMNLQHADSRYRQAVHGFTLLVTVTKYQIKPLGLYELDMRLISNVFSAVASFLLI 391
            .|||:..:||..:|||||:|::|.|:.|.|.|....|::.||||.||:..|::.|||:....|||
  Fly   348 ETRRTGELLQRFDLQHADARFKQVVNAFWLQVVTINYKLMPLGLLELNTSLVNKVFSSAIGSLLI 412

  Fly   392 LVQADLSQRFKMQ 404
            |:|:||:.||.::
  Fly   413 LIQSDLTLRFSLK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr94aNP_732816.1 7tm_7 19..399 CDD:285581 148/386 (38%)
Gr97aNP_001287551.1 7tm_7 54..419 CDD:285581 141/365 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CCZD
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0020129
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.