DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr97a and Gr93b

DIOPT Version :9

Sequence 1:NP_001287551.1 Gene:Gr97a / 117338 FlyBaseID:FBgn0041224 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:426 Identity:87/426 - (20%)
Similarity:173/426 - (40%) Gaps:90/426 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LHTQLVTICLYATVFLNILYGVYLGRFSFRRKK------FVFSKGLTIYSLFVATFFALFYIWNI 86
            |:...::..|..:.|   |||.:.|..:||.::      .:..:|.....|.:....:.||.:: 
  Fly    14 LNVSRISAILLRSCF---LYGTFFGVITFRIERKDSQLVAINRRGYLWICLVIRLLASCFYGYS- 74

  Fly    87 YNEISTGQ---INLRDTIG---IYCYMNVCVCLFNYVTQW--EKTLQII-RFQNSVPLFKVLDSL 142
            |:..| ||   :.||...|   |.|.  :|..:...:..|  |:.:.:: ||   :.||:.:.||
  Fly    75 YDAWS-GQYEDMYLRAFFGFRLIGCL--ICSVIILVMQFWFGEELINLVNRF---LQLFRRMQSL 133

  Fly   143 ---------DISAMIVWRAFIYGLLKIVFCPLITYITLILYHRRSISESQWTSVTTTKTMLPLIV 198
                     |.:..::..:.::.||.:...     ..|:|        |.|..:|....:...:.
  Fly   134 TNSPKNRFGDRAEFLLMFSKVFSLLFVFMA-----FRLML--------SPWFLLTLVCDLYTSVG 185

  Fly   199 SNQINN-CFFGGLV-------LANLIFAAVNRKLHGIVKEANMLQSPVQ------MNLHKPYYRM 249
            :..|.: ||.|.|.       |.|.:...:..:|..:..|.|..::..|      .||.|..|  
  Fly   186 TGMITHLCFVGYLSIGVLYRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLY-- 248

  Fly   250 RRFCELADLLDELARKYGFTASRSKNYLRFTDWSMVLSMLMNLLGITMGCYNQYLAIADHYINEE 314
                    |.||:.:.       |:::.:..|..:.||:..:||.::|..|:..|.      .:.
  Fly   249 --------LYDEIHQV-------SRSFQQLFDLPLFLSLAQSLLAMSMVSYHAILR------RQY 292

  Fly   315 PFDLFLAIVLVVFLAVPFLELVMVARISNQTLVETRRTGELLQRFDLQHADARFKQVVNAFWLQV 379
            .|:|: .:|:.:.:.|..|.:.:.:.::...|:  ||..  .:.|.:..:.: :.|.:..|..::
  Fly   293 SFNLW-GLVIKLLIDVVLLTMSVHSAVNGSRLI--RRLS--FENFYVTDSQS-YHQKLELFLGRL 351

  Fly   380 VTINYKLMPLGLLELNTSLVNKVFSSAIGSLLILIQ 415
            .....::.||||.|::..|.....|:.:..|:.|:|
  Fly   352 QHQELRVFPLGLFEVSNELTLFFLSAMVTYLVFLVQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr97aNP_001287551.1 7tm_7 54..419 CDD:285581 80/400 (20%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 85/416 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.