DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr93a

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:381 Identity:72/381 - (18%)
Similarity:132/381 - (34%) Gaps:115/381 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EFFTRTLRKRRRFCWMAGY-----SLYLIAILLMVFYE----FHANIVSLHLEIYKFHVEDFSKV 86
            |...|.|...:|.|.....     :.:::..||.:|:.    || .|:.|   ....|.:|.|::
  Fly   120 EVLNRYLALYQRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFH-EIIPL---FENSHFDDISQM 180

  Fly    87 MGRTQKFLIVAIATCNQLN-ILLNYGRLGLIYDEIANLDLGIDKSSKNFCGKSHWWSFRLRLTLS 150
            :| |...:.:.:.|...|: ..|.:...|::|:.:||..:.:.|..:....:..    |.|:|  
  Fly   181 VG-TGFGIYMWLGTLCVLDACFLGFLVSGILYEHMANNIIAMLKRMEPIESQDE----RYRMT-- 238

  Fly   151 IGLWMVIIIGVIPRLTLGRAGPFFHWVNQVLTQIILIMLQLKGPEYCLFVLLVYELILRTRHVLE 215
                                                        :|            |...:|.
  Fly   239 --------------------------------------------KY------------RRMQLLC 247

  Fly   216 QLKDDLEDFDCGARIQELC-VTLKQNQLLIGRIWRLVDEIGAYFRWSMTLLFLYNGLTILHVVNW 279
            ...|:|:  :|.|...||. ||....::|   .|:::..|  |..:....|.||.  .|||.:| 
  Fly   248 DFADELD--ECAAIYSELYHVTNSFRRIL---QWQILFYI--YLNFINICLMLYQ--YILHFLN- 302

  Fly   280 AIIRSIDPNDCCQLNRLGSITFLSF--------NLLLTCFFSECCVKTYNSISYILHQIGCLPTA 336
                    :|        .:.|:|.        ||:|....::..|:.......:...|.|....
  Fly   303 --------DD--------EVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKLPLDIVCSDMD 351

  Fly   337 EEFQMLKMGLKEYILQMQHLKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQFKI 392
            |.:.   ..::.::.|:|..:|.....|.|.:|.:....:|..:..|:.|::||.|
  Fly   352 ERWD---KSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 72/381 (19%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 72/381 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.