DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr68a

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:251 Identity:57/251 - (22%)
Similarity:94/251 - (37%) Gaps:80/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QIILIMLQLKGPEYCLFVLLVYE----LILRTRHV--------LEQLKDDLEDFDCGARIQELCV 235
            ||||:::        .|:.|:|.    |.|||..:        |.|..|.....|||.       
  Fly   164 QIILLLI--------YFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGH------- 213

  Fly   236 TLKQNQLLIGRIWRLVD---EIGAYFRW---------SMTLLFLYNGLTILHVVNWAIIRSIDPN 288
              .:|       ||.:.   |:...||:         .::||| |.|.:...|.|.:.:...   
  Fly   214 --MEN-------WRELSNLIEVLCKFRYITENINCVAGVSLLF-YFGFSFYTVTNQSYLAFA--- 265

  Fly   289 DCCQLNRLGSITFLSFNLLLTCFF------------SEC--CVKTYNSISYILHQIGCLPTAEEF 339
             ......|.|.|.::..:.|:|.:            |.|  .....|..:.||.:|  ...:::|
  Fly   266 -TLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARI--YGKSKQF 327

  Fly   340 QMLKMGLKEYILQMQHLKLLFTCGGLFDIN----IKLFGGMLVTLCGYVIIIVQFK 391
            |.|   :.:::.:.....|.||..|.|.|:    .|:|..:..    |::|::|||
  Fly   328 QNL---IDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTT----YLVILIQFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 57/251 (23%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 57/251 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.