DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr98c and Gr59f

DIOPT Version :9

Sequence 1:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:272 Identity:48/272 - (17%)
Similarity:108/272 - (39%) Gaps:64/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VIIIGVIPRLTLGRAGPFFH-WVNQVLTQIILIMLQ-------LKGPEYCLFVLLVYELILRTRH 212
            :.::|:...|.:     ||: |.::.:....::.:.       :....:..:.||:..:..|.|.
  Fly   157 LFLVGIFACLAI-----FFNIWTHKFVVYRSILSINSYVMPNIISSISFAQYYLLLQGIAWRQRR 216

  Fly   213 VLEQLKDDLEDFDCGARIQEL-CVTLKQNQLL-----IGRIWR---LVDEIGAYFRWSMTLLFLY 268
            :.|.|:.:|.... ..||.|: .:.:....|:     :.|.::   |:..:|.:..:::.|..:|
  Fly   217 LTEGLERELTHLH-SPRISEVQKIRMHHANLIDFTKAVNRTFQYSILLLFVGCFLNFNLVLFLVY 280

  Fly   269 NGL---TILHVVNWAIIRSIDPNDCCQL----NRLGSI-TFLSFNLLLTCFFSECCVKTYNSISY 325
            .|:   ::.....|.          |.|    ..:|.: :.|.||..:....| .|:...:.:||
  Fly   281 QGIENPSMADFTKWV----------CMLLWLAMHVGKVCSILHFNQSIQNEHS-TCLTLLSRVSY 334

  Fly   326 ILHQIGCLPTAEEFQMLKMGLKEYILQM-----QHLKLLFTCGGLFDINIKLFGGMLVTLCGYVI 385
            ....|            :..:..:|:||     ||:    .| |:.::::|....:||....:.|
  Fly   335 ARKDI------------QDTITHFIIQMRTNVRQHV----VC-GVINLDLKFLTTLLVASADFFI 382

  Fly   386 IIVQFKIQDFAL 397
            .::|:.:...||
  Fly   383 FLLQYDVTYEAL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 46/266 (17%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 46/264 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.